KEGG   Anaplasma marginale St. Maries: AM230Help
Entry
AM230             CDS       T00216                                 

Gene name
sucD
Definition
(GenBank) succinyl-CoA ligase chain A
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
ama  Anaplasma marginale St. Maries
Pathway
ama00020  Citrate cycle (TCA cycle)
ama00640  Propanoate metabolism
ama01100  Metabolic pathways
ama01110  Biosynthesis of secondary metabolites
ama01120  Microbial metabolism in diverse environments
ama01130  Biosynthesis of antibiotics
ama01200  Carbon metabolism
Module
ama_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ama_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ama00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AM230 (sucD)
   00640 Propanoate metabolism
    AM230 (sucD)
   00660 C5-Branched dibasic acid metabolism
    AM230 (sucD)
Enzymes [BR:ama01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AM230 (sucD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: AAV86340
Position
complement(190828..191712)
Genome map
AA seq 294 aa AA seqDB search
MSVLVDKNTRVICQGFTGSNGTFHSEQAIAYGTKVVGGVTPGKGGTTHLGLPVFDTVLQA
KVETQANASVIYVPAPYAADAIFEAIEAEIELIVCITEGIPVLDMVQVKRALAGSKSRMI
GPNCPGIITPEECKIGIMPGYIHKKGNIGVVSRSGTLTYEAVAQTTAVGLGQSTCIGIGG
DPVHGMSFLDCVQLFLEDEDTHGIVIIGEIGGSEEEEAVEFLQSSGTKKPVVGFVAGQTA
PPGKRMGHAGAISSGSSGTAKGKIEFMKRAGVAVAETPAVIGKTVLDVMGKRNS
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttttggtggacaaaaacacaagggttatatgtcaaggctttaccggctctaac
gggacttttcactccgagcaggcgattgcctacggcactaaggtggttggcggagtaacc
ccgggtaagggtggtactacacaccttgggctaccggtgtttgacactgtgctgcaggca
aaagtcgagactcaggcaaatgcaagtgtgatatacgtccctgctccgtacgccgctgat
gcgatattcgaggctatagaggccgaaattgaactcatagtttgcattacagagggcata
cccgttcttgatatggtgcaggtaaagagggcgcttgctggctctaagagtcggatgatt
ggcccgaactgccccggaataataacacccgaagagtgcaagataggcattatgccgggg
tacatccataaaaaaggtaacataggggtggtttcccgttctggaaccctaacctacgag
gcagtggctcagaccacagcagtggggctgggccagtcaacttgcatagggattgggggg
gacccagttcatggaatgtcattcctagattgcgttcagctgtttttggaagatgaagac
acccacggtattgtgataataggcgagataggaggctctgaggaagaggaagcagtagag
tttctccaatcctcaggcacaaaaaaacccgtggtaggctttgttgccggacagaccgcc
cctccaggcaaacgtatggggcacgccggcgccatatcctctggaagttcaggcacggcc
aagggcaagatcgagttcatgaagcgcgccggagtcgccgtggcagaaaccccggcagta
ataggaaaaactgttctggatgttatgggaaagcgcaactcgtag

DBGET integrated database retrieval system