KEGG   Anaplasma marginale St. Maries: AM463Help
Entry
AM463             CDS       T00216                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase proenzyme
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
ama  Anaplasma marginale St. Maries
Pathway
ama00564  Glycerophospholipid metabolism
ama01100  Metabolic pathways
ama01110  Biosynthesis of secondary metabolites
Module
ama_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:ama00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AM463 (psd)
Enzymes [BR:ama01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     AM463 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AAV86505
UniProt: Q5PB25
Position
complement(416989..417693)
Genome map
AA seq 234 aa AA seqDB search
MRYVVVYMSFPSIHRHGYPFICLAFLCSCIGFALSSSLGVIFAMITALCAYFFRDPIRVI
PLNDALVASPADGVVTSIVEVESPLNDGKTVTRISIFLSLFDVHVNRVPVSGVVKSVEHR
PGSFSSAGSGGAVNENERVRAVIESSVGGHCIVVEQIAGVLARRIVCDLESGKAAKLGSR
MGIIRFGSRMNIYIPAGMPVSVAEGHTVVGGETIIASLDADMATVHKDLTFDKV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
ttgcggtatgtagtagtgtacatgagttttcctagtattcacaggcatgggtacccattc
atatgcctggcctttctttgttcgtgcattggtttcgcgctctcttcgagcttgggcgta
attttcgcaatgataactgcactttgtgcttactttttccgcgatcccatacgcgtcata
ccgttaaatgacgcattggtagcgagtccagcggacggggttgttacttcaattgtggag
gtcgagtctcccttgaacgatggcaagacagtaaccagaataagcatctttcttagtctg
tttgacgtgcacgttaatcgcgtacctgtttccggagtggtcaagtccgttgagcaccgg
cccggcagtttctcctctgcaggttcgggtggagcagtaaatgagaatgagcgcgtaagg
gcagtgattgagtcatccgtaggtggtcactgcatagtggtggagcagattgccggggtg
ctggcacgcaggatagtgtgcgatctggagtccggaaaagctgcaaaacttggttcgaga
atgggaattatcaggtttggaagcagaatgaacatttacatccctgcggggatgccagta
tccgtggcggagggtcatacggtagtgggtggggagaccataatcgcctcacttgatgct
gatatggctactgttcacaaggatctgactttcgataaggtatag

DBGET integrated database retrieval system