KEGG   Anaplasma marginale St. Maries: AM717Help
Entry
AM717             CDS       T00216                                 

Gene name
orfX
Definition
(GenBank) ORF X
Organism
ama  Anaplasma marginale St. Maries
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbC MttA_Hcf106
Motif
Other DBs
NCBI-ProteinID: AAV86678
Position
complement(659399..659770)
Genome map
AA seq 123 aa AA seqDB search
MLLKLRFLLIAGVLAFGILHGVPAGAEAAKDDDTATVVICNVIRFVQKLGLPIMTGVILG
SSIMAIFGKLAWPAIVMLVVFTAIFFGAGKLMAKFAKGLGGENENFDCAQHTAVNSSPKP
AKP
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgttgctaaaacttagattcttactcattgctggagtattagcatttggtatcttacat
ggtgtacctgctggggctgaggctgctaaggatgatgatacagcgactgttgttatatgt
aacgttatacggtttgtgcagaagctgggactacccatcatgactggagtgatactaggt
tctagcattatggctatctttggtaagcttgcatggcctgctattgtaatgttggttgta
tttacagctatattctttggtgctggtaagcttatggctaagtttgctaaggggttgggt
ggcgaaaatgagaacttcgactgtgcacagcatacagcagtcaacagcagccccaagcca
gccaagccctaa

DBGET integrated database retrieval system