KEGG   Anaplasma marginale St. Maries: AM907Help
Entry
AM907             CDS       T00216                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal subunit L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ama  Anaplasma marginale St. Maries
Pathway
ama03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ama00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AM907 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ama03011]
    AM907 (rplV)
Ribosome [BR:ama03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AM907 (rplV)
  Bacteria
    AM907 (rplV)
  Archaea
    AM907 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AAV86817
UniProt: Q5PA63
Position
complement(828779..829117)
Genome map
AA seq 112 aa AA seqDB search
MTTVISARVSGLRSTPSKLNLVADLIRGQDVSTAVMYLKFCRKKAAFLVGKVLKSAVANA
RANYDVDLDSLYVKEVLVGKSFTLRRVRPRARGRACRIRKRYGSVVIRLLKR
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgactactgttatcagtgctagagtgtcgggtctcaggtctacgccctctaagttgaat
ttggttgcggacctgataagaggtcaggacgtgtccacggccgtgatgtaccttaagttt
tgcaggaagaaggccgcatttcttgttggaaaggtgctcaagtccgctgtagctaacgct
agggccaactacgacgtcgacttggatagtttgtacgtgaaggaggttttagttggtaag
tccttcactctgcgcagggttcggcccagggcgcggggtagggcatgcaggataagaaag
cggtatgggagcgttgtaattagattgttgaaaaggtaa

DBGET integrated database retrieval system