KEGG   Alteromonas mediterranea DE1: amad1_08115Help
Entry
amad1_08115       CDS       T02340                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K22602  oxamate amidohydrolase [EC:3.5.1.126]
Organism
amaa  Alteromonas mediterranea DE1
Pathway
amaa00230  Purine metabolism
amaa01100  Metabolic pathways
amaa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:amaa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    amad1_08115
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:amaa01002]
    amad1_08115
Enzymes [BR:amaa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.126  oxamate amidohydrolase
     amad1_08115
Peptidases and inhibitors [BR:amaa01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   amad1_08115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AFV85134
Position
complement(1825222..1826799)
Genome map
AA seq 525 aa AA seqDB search
MSEKPNIAFTAPHYAASQVGLNILEKGGTAIEAMVAAAASIAVEYPHMNGMGGDGFWLIS
EPGKSPVGIDASGVAAKGATPSFYEGFDAIPSRGGKSALTMAGAVAGWQKALEISHSWQS
GLPLSTLFDTAISQANWGIEVTQSLVDASNKTFEELSSDENFAQFLIKGKALKKGKILKL
TKLSETLKHLADKGLDDFYHGELATQLAEDLEAAGSPIRLEDFKNYEAKLVEPLSVSTSK
GKLYNLPAPTQGVASLIILALYDKVQHLGSTDADMVHLLIECTKQAFIARNANVTDPSRT
PVSLQSLLSDDVLEEMAKNISLDKALPWPHEAKHGDTIWMGCCDSEGRMVSYIQSLYWEF
GSGVVSPQTGIVWNNRGTSFSLDPSSNQYLAPGLKPFHTLNPAFAELIDGRRMSYGTMGG
EGQPQTQAALFARHIYHGQPIAKAISLGRWLLGRTWGDQSHNLKAERDLVEYVGDSLLAR
GHDMVTEDPCNELMGHAGAIIRDTEGTVNGASDPRSDGKAFFGHR
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaaaccgaacatcgcgtttactgcgccccattatgctgcatcacaagtgggt
ttaaacattttagagaaaggcggcacggccattgaagctatggtggcggcagcggcatca
attgccgttgagtacccgcacatgaatggtatgggcggtgatggcttttggcttatcagc
gaaccgggcaaaagccctgttggtatcgatgcgtctggtgttgccgcaaaaggcgcgacg
ccgtcgttttacgaaggctttgatgcaattccaagcaggggcggaaagtcggcgctaacc
atggccggcgcagtagcggggtggcagaaagccttagagataagccattcttggcaaagc
gggctgccgctaagtacgttatttgataccgccatcagccaagccaactgggggatagaa
gttacccaaagcctggttgacgcaagcaataaaactttcgaggaactcagtagcgatgaa
aactttgcccagtttttaataaagggcaaagcccttaaaaaaggtaaaattttaaagctt
actaaactgtctgaaaccttgaagcatttggcagataaaggcttggatgatttttatcac
ggcgaacttgccacacaactcgctgaagatttagaagcggcaggctcccctattcgctta
gaagatttcaaaaattacgaggcaaaattagtagagccgctatcggtgtctaccagtaaa
ggtaagctttataacttaccggcgcccacgcaaggggtggcgtcgctgattattttggcg
ctgtacgacaaagttcaacacttaggcagtaccgatgccgacatggtgcacctgctcatt
gagtgtacaaagcaagcctttatcgctcgtaacgctaacgtgaccgacccgtcgcgcaca
ccggtgagcttacaaagcctattaagcgacgacgtgcttgaagaaatggccaagaacatc
tcgttagacaaagccttgccatggccacatgaagcaaaacacggcgacaccatttggatg
ggctgctgtgactctgaaggtcgcatggtgagctatattcagtccctttactgggaattt
ggctccggcgtagtaagcccacaaaccggtattgtttggaataaccgcggcacgtcgttc
tcacttgacccaagcagcaatcaatacctagcacctggtttaaagccgtttcacacgcta
aacccagcttttgcagagcttattgatggccgccgaatgagttacggcaccatgggcggt
gaaggacaaccgcaaacccaagccgctctatttgcgcgtcacatttatcacggccaacct
attgcaaaagcgatttcgttaggacgctggttacttggcagaacgtggggcgatcaaagc
cacaacttaaaagccgagcgcgacttggttgaatacgtaggtgatagtttgctagcccgc
ggtcacgacatggttacggaagacccatgcaacgaattgatgggccacgccggcgccatc
attcgcgacactgagggaacggttaacggtgccagcgatccgcgcagcgacggtaaggct
ttctttggtcaccgttaa

DBGET integrated database retrieval system