KEGG   Alteromonas mediterranea DE1: amad1_10285Help
Entry
amad1_10285       CDS       T02340                                 

Definition
(GenBank) putative succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with sdhC
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
amaa  Alteromonas mediterranea DE1
Pathway
amaa00020  Citrate cycle (TCA cycle)
amaa00190  Oxidative phosphorylation
amaa00650  Butanoate metabolism
amaa01100  Metabolic pathways
amaa01110  Biosynthesis of secondary metabolites
amaa01120  Microbial metabolism in diverse environments
amaa01130  Biosynthesis of antibiotics
amaa01200  Carbon metabolism
Module
amaa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amaa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
amaa_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:amaa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    amad1_10285
   00650 Butanoate metabolism
    amad1_10285
  Energy metabolism
   00190 Oxidative phosphorylation
    amad1_10285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AFV85564
Position
2281978..2282325
Genome map
AA seq 115 aa AA seqDB search
MVTNQASIKRDGVQDYVSLRATAAIIFAYSVFMAWFFITTDNLTFIEWRGLFSGLAMKVF
TLAALVAVMIHVRIGLWQVLTDYVKATGLRAVLQYILNIIAFGYVAVGLFVLWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaaccaagcaagcataaagcgtgacggcgtacaagactacgtatctcttcgc
gcaacagcagcgataattttcgcgtactcggttttcatggcgtggttttttattaccacc
gataacttaacgtttatcgaatggcgaggtttgttctctggcctagctatgaaagttttc
acattggcagcactagtagcagtgatgatccacgtgcgtatcggcctttggcaggtactt
acagactatgttaaagcgacaggtctacgtgcggtactacaatatatattaaatatcatc
gcgttcggctacgtagctgtgggcctattcgtattgtggggagtgtaa

DBGET integrated database retrieval system