KEGG   Alteromonas mediterranea DE1: amad1_10310Help
Entry
amad1_10310       CDS       T02340                                 

Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
amaa  Alteromonas mediterranea DE1
Pathway
amaa00020  Citrate cycle (TCA cycle)
amaa00640  Propanoate metabolism
amaa00660  C5-Branched dibasic acid metabolism
amaa01100  Metabolic pathways
amaa01110  Biosynthesis of secondary metabolites
amaa01120  Microbial metabolism in diverse environments
amaa01130  Biosynthesis of antibiotics
amaa01200  Carbon metabolism
Module
amaa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amaa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:amaa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    amad1_10310
   00640 Propanoate metabolism
    amad1_10310
   00660 C5-Branched dibasic acid metabolism
    amad1_10310
Enzymes [BR:amaa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     amad1_10310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AFV85569
Position
2289494..2290660
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFKEYGLPVSEGYAADTAQGAVEAADRIGGEEWVVKCQVHAGGRGKAGGV
KLVKNKDDIRAFAENWLGKNLVTFQTDENGQPVSKILVESCTDIANELYLGAVVDRTTRR
VVFMASTEGGVEIETVAEETPEKILKAEIDPIVGPQPYQAREMAFALGLSGVQIKQFTQI
FLGLAKMFEELDVALIEINPLVIKTDGNLHCLDAKVGIDGNALYRQPKLKDMQDPSQEDA
REAHAAQWELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVAE
AFKIILSDDNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVEVPVVVRLEGTNAELGREV
LANSGLDIIAAESLTDAAQKVVAAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgaataccaaggtaagcagctattcaaagaatacggcttgcctgtttct
gaaggatacgcagcagacactgctcaaggtgctgtagaagccgctgaccgaatcggcgga
gaagagtgggtagttaagtgtcaggtacacgcgggcggtcgcggtaaagctggcggtgta
aagctagttaaaaacaaagacgacattcgcgctttcgctgaaaactggcttggcaaaaat
ttggtgactttccagactgacgaaaacggtcagcctgtgagcaaaatcctagttgaatct
tgcacagatatcgctaacgagctttaccttggtgcagtagttgaccgtacaacccgtcgc
gttgtatttatggcatctactgaaggtggcgttgagattgaaactgttgcagaagaaacc
ccagagaagatccttaaagctgaaatcgacccaatcgtaggtcctcagccttaccaagca
cgcgaaatggcgtttgctcttggtctttctggcgttcaaattaagcaattcactcaaatc
ttccttggcctagctaagatgtttgaagagcttgacgttgcacttatcgaaattaacccg
ttagttatcaaaactgacggtaacctacactgcctagacgcaaaagtaggtatcgatggt
aacgcgctatatcgtcagcctaagctgaaagatatgcaagatccttcgcaagaagacgcc
cgtgaagctcacgcagctcagtgggaactaaactatgttgcactagacggtaacgtaggt
tgtatggttaacggtgctggccttgcaatgggtactatggacatcgtaaacctacacggc
ggcaagccagctaacttcctagacgttggtggcggcgcgactaaagagcgtgtagctgaa
gcattcaaaatcatcctttctgatgacaatgttaaagcggtattggttaacatcttcggt
ggtatcgtacgctgtgacatgatcgcagaaggtattatcggtgcggttaaagaagttggc
gtagaagtaccagtagttgtacgtcttgaaggtaccaatgcagagcttggccgtgaagtt
ctagcgaactcaggtcttgatatcattgctgctgaatcgctaactgatgcagcacagaaa
gttgttgctgcagcggagggcaaataa

DBGET integrated database retrieval system