KEGG   Alteromonas mediterranea DE1: amad1_17380Help
Entry
amad1_17380       CDS       T02340                                 

Definition
(GenBank) trans-2-enoyl-CoA reductase
  KO
K00209  enoyl-[acyl-carrier protein] reductase / trans-2-enoyl-CoA reductase (NAD+) [EC:1.3.1.9 1.3.1.44]
Organism
amaa  Alteromonas mediterranea DE1
Pathway
amaa00061  Fatty acid biosynthesis
amaa00650  Butanoate metabolism
amaa01100  Metabolic pathways
amaa01120  Microbial metabolism in diverse environments
amaa01200  Carbon metabolism
amaa01212  Fatty acid metabolism
Module
amaa_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:amaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    amad1_17380
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    amad1_17380
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:amaa01004]
    amad1_17380
Enzymes [BR:amaa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     amad1_17380
    1.3.1.44  trans-2-enoyl-CoA reductase (NAD+)
     amad1_17380
Lipid biosynthesis proteins [BR:amaa01004]
 Fatty acid synthase
  Component type
   amad1_17380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enoyl_reductase Eno-Rase_NADH_b Eno-Rase_FAD_bd
Motif
Other DBs
NCBI-ProteinID: AFV86955
Position
complement(3918733..3919911)
Genome map
AA seq 392 aa AA seqDB search
MVIKPKVRGFICTNAHPVGCAKAVDEQIAYVEAKGDLGEGPKNVLVIGSSTGYGLASRIT
SAFGYGAKTLGVCFERAPTERKTGTAGWYNTAAFHEKAKGKGLYADTINGDAFSDEIKNE
AIEKIKAEMGKVDLVIYSLASPRRTDPETGVTYKSTLKPVGEAYTTKTYDTDKDKVHEVA
LEPANDDEILNTIKVMGGEDWERWMDFLREADVLAEGCKTTAYTYIGKELTWPIYGQATI
GKAKEDLDRAAAAIIGKNSDLLVQANVSSLKALVTQASSAIPVMPLYISLIYKVMKEEGT
HEGCIEQIHGLFTQCLFGNTPTLDEANRYRMDGKETNDATQAKIKALWDQVTQENFHDLS
DYKGYHHEFLKLFGFDISSVDYDSEVDPLVKW
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggttatcaagcctaaagtgagaggcttcatttgtacaaacgcgcacccagtgggctgt
gctaaagcggttgatgaacagattgcttatgtagaagcaaaaggtgacttaggcgaaggc
cctaaaaatgtactggttattggtagctcaacaggctatggcttagcgtcgcgcatcaca
tctgcctttggttatggtgctaaaacactaggtgtgtgctttgaaagagcaccaacggag
cgcaaaacgggtactgctggttggtataacactgcggcgttccacgaaaaagccaaaggg
aaaggcttgtatgcagatacaataaacggcgatgctttttctgatgagatcaaaaacgaa
gctatcgaaaaaatcaaagccgaaatgggcaaggtcgacttggttatttatagccttgcg
tctccgcgcagaaccgacccagaaactggtgtgacctacaagtcgacgcttaagccagta
ggcgaggcatacaccacaaaaacttacgacacagataaagataaagtgcatgaagtggcg
cttgagccagccaacgacgacgagatccttaacaccattaaagtgatgggcggcgaagat
tgggagcgttggatggactttttgcgtgaagccgatgtgcttgcagaaggctgtaaaacc
accgcatatacctatatcggtaaagagcttacatggcctatctacggtcaagcaactatc
ggtaaggcaaaagaagacctagatcgcgctgctgctgctattattggtaaaaacagtgac
ttgcttgtacaagcaaacgtaagttcactaaaagcactggtaacgcaggcaagttctgcc
attcccgtaatgcctctgtatatttcacttatttacaaagtgatgaaagaagaggggaca
cacgaagggtgtattgaacaaattcatggtttattcacacaatgcctgtttggaaatact
cctacgctagatgaagcaaatcgctatcgcatggacggcaaagaaaccaacgacgctacc
caagcaaaaattaaagcgctatgggatcaggtgacacaagagaacttccatgacttaagt
gactacaaaggttaccaccacgagttcttaaaactattcggttttgacatttccagtgtt
gattacgacagtgaagttgacccactggttaagtggtaa

DBGET integrated database retrieval system