KEGG   Alteromonas mediterranea DE1: amad1_20315Help
Entry
amad1_20315       CDS       T02340                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
amaa  Alteromonas mediterranea DE1
Pathway
amaa00010  Glycolysis / Gluconeogenesis
amaa00052  Galactose metabolism
amaa00500  Starch and sucrose metabolism
amaa00520  Amino sugar and nucleotide sugar metabolism
amaa00521  Streptomycin biosynthesis
amaa01100  Metabolic pathways
amaa01110  Biosynthesis of secondary metabolites
amaa01120  Microbial metabolism in diverse environments
amaa01130  Biosynthesis of antibiotics
amaa01200  Carbon metabolism
Module
amaa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
amaa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:amaa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    amad1_20315
   00052 Galactose metabolism
    amad1_20315
   00500 Starch and sucrose metabolism
    amad1_20315
   00520 Amino sugar and nucleotide sugar metabolism
    amad1_20315
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    amad1_20315
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    amad1_20315
Enzymes [BR:amaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     amad1_20315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase HTH_6
Motif
Other DBs
NCBI-ProteinID: AFV87536
Position
complement(4604119..4605072)
Genome map
AA seq 317 aa AA seqDB search
MSHKFVADVGGTNIRLARVTETGVADIIKYMCNDFASIDLAIAQYFADLPQYAFTEGCIA
IACPVLGDQVEMTNHSWAFSQNALRSQLKLDALYVINDFTAVAHSLPVLSDEQVVQIGEG
TAKANGNIAVFGPGTGLGVEHITMTSSGWQTLDGEGGHVDFAPVDETDVIVWRHLQATFG
RASAEEVMSGRGIHNIYTALANNAGEPVTFADPAQITEAAIAGTCKIAEATLTQFCRIMG
SFAGNLALNMATTGGIFIGGGIANRFPEFIKNSDFRARFEAKGQMKHYVKDIPTYLIAEP
DHGLLGAAAYLNQNTAS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagtcataagtttgttgctgatgttggcggtactaatatccgtttagcgcgtgtaaca
gagacaggcgttgccgatattatcaaatatatgtgcaatgacttcgccagtattgacctt
gccattgctcaatattttgctgatttaccgcaatatgcgttcacagaaggctgtatagcc
attgcttgcccagtgttaggcgaccaagtggaaatgactaaccacagttgggcgttttca
caaaatgcgttgcgttcacaattaaagctggacgccttgtatgtgattaatgacttcact
gcagttgcgcattcattaccggttttaagtgatgaacaagttgttcaaataggcgaggga
accgctaaagctaatggaaacattgcggtatttggccctggtactggccttggtgttgaa
catatcaccatgacatcttctggttggcaaacccttgatggcgaaggcggtcacgttgac
tttgcccctgtagatgaaaccgatgtgattgtgtggcgccatcttcaggctacttttgga
cgcgcatcagctgaagaagtgatgtcagggcgtggtatacacaatatttatactgcgctg
gcaaacaacgccggtgagccggttacatttgctgatcctgctcagattactgaagcggct
atcgcgggaacctgcaaaattgccgaagctacactgacgcagttttgtcgcataatgggt
agctttgccggaaacttggccctgaatatggccacgaccggcggcatttttattggcggt
ggtatcgctaatcgttttcctgagtttataaaaaatagtgacttcagagcccgtttcgaa
gctaaaggccaaatgaagcactacgtaaaagacattcccacctatttgatagcagaacct
gaccatggccttcttggcgcagctgcttatctaaatcaaaatacagcgagctaa

DBGET integrated database retrieval system