KEGG   Alteromonas macleodii ATCC 27126: MASE_01585Help
Entry
MASE_01585        CDS       T02246                                 

Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
amac00860  Porphyrin and chlorophyll metabolism
amac01100  Metabolic pathways
amac01110  Biosynthesis of secondary metabolites
amac01120  Microbial metabolism in diverse environments
Module
amac_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:amac00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MASE_01585
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:amac01007]
    MASE_01585
Enzymes [BR:amac01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     MASE_01585
Amino acid related enzymes [BR:amac01007]
 Aminotransferase (transaminase)
  Class III
   MASE_01585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AFS35886
Position
complement(366644..367924)
Genome map
AA seq 426 aa AA seqDB search
MQKSEALFTRAQKTIPGGVNSPVRAFKAVGGTPRFITKADGAYMWDADGKQYIDYIQSWG
PMVLGHNNAQIREAVIEASYNGLSFGAPTEAEVIMAELVSELVPSMEMVRMVNSGTEATM
SAIRLARGYTSRNKIVKFEGCYHGHADSLLVKAGSGALTLGVPSSPGVPANVAEHTLTVE
YNNLDSVKEIFEAHGDDIACIIVEPVAGNMNCIPPVEGFLEGLRAICDQYGSVLIFDEVM
TGFRVSRGGAQERYNIKPDLTCLGKVIGGGMPVGCFGGRRDIITHIAPTGPIYQAGTLSG
NPVAMAAGLAALTQIKQPGLYDSIFENTQTLVDGFQALADKHNISLTTNIAGSMFGIFFT
DVEKVTNYKQAINCNTEQFNKFYHGMLEQGVYLAPASYEAGFVSKAHDAAVIEQTLAAAD
KVFSTL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaatctgaagccctatttacccgcgcccaaaaaaccattcctggtggcgtaaat
tcacccgttcgcgcttttaaagcggtaggcggtacacctcgcttcatcacgaaagctgat
ggcgcgtacatgtgggatgcggatggtaagcaatatattgactatattcagtcttggggc
cctatggttctaggtcacaataacgcccaaattcgcgaagcggttattgaagcgtcgtat
aacggactgtctttcggtgcacctaccgaagctgaagtgatcatggctgagttggttagc
gaactggttccatctatggaaatggtacgcatggtgaactctggtacagaggccaccatg
tcagctattcgcctggctcgcggctacacgagcagaaacaaaattgttaagtttgaaggc
tgctatcacgggcacgccgactcactgctagtgaaagcgggctcaggggcgctaaccctt
ggtgtaccaagttcaccaggtgttccagcaaatgttgctgagcatacgcttaccgttgaa
tacaacaacctagacagcgtaaaagaaatcttcgaagcccatggcgatgatattgcgtgc
attatcgttgaacctgtcgcaggtaacatgaactgtatccctcctgtggaaggcttcctt
gaaggacttcgcgctatttgcgaccaatatggcagcgtattgatttttgatgaagtaatg
acaggcttccgcgtatctcgcggcggggcgcaagagcgttataacatcaaaccagacctg
acttgcttgggtaaagtcattggcggcggcatgccagtgggctgttttggtggccgtcgt
gacattattactcacatagcaccgacagggccaatttaccaggcgggtacgctttctggt
aacccagtagctatggctgcgggtcttgctgcgttaacacagataaaacagcctggactt
tacgattcaattttcgaaaatacgcaaacgctagtagatggtttccaagcccttgctgac
aaacacaatattagtctaactactaatattgccggcagtatgtttgggatattctttact
gacgtagagaaagtcacgaactacaagcaagcaattaactgtaataccgagcaattcaac
aagttctatcacggtatgctagagcaaggcgtttacttagcacctgcatcttatgaagcg
ggctttgtttctaaagcgcatgacgctgcagtcattgagcaaacccttgctgcagcagat
aaagtgttctcaacgctttaa

DBGET integrated database retrieval system