KEGG   Alteromonas macleodii ATCC 27126: MASE_02145Help
Entry
MASE_02145        CDS       T02246                                 

Definition
(GenBank) gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
amac00430  Taurine and hypotaurine metabolism
amac00460  Cyanoamino acid metabolism
amac00480  Glutathione metabolism
amac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    MASE_02145
   00460 Cyanoamino acid metabolism
    MASE_02145
   00480 Glutathione metabolism
    MASE_02145
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:amac01002]
    MASE_02145
Enzymes [BR:amac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     MASE_02145
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     MASE_02145
Peptidases and inhibitors [BR:amac01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   MASE_02145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AFS35993
Position
complement(492475..494193)
Genome map
AA seq 572 aa AA seqDB search
MKKRIANVGFISVIVAFISVVAACSHAPNPPVDSASNNTVGLSQQAVAMPDSYSADAAMQ
VLQEGGNAIDAAITAQFVLAVTLPEAGNVGGGGFMTIKFEDNTDFLDYREMAPENAHRDM
YLDEQGDVKPYESLFGAKASGIPGTVAGMWAAHKKYGTLDWERLLAPAVDLAEQGFVVHE
KLANNIDHYIERTKEAAINNNFSEYFAHAKAGTTFKQPELAKTLKAIQQQGKDGFYKGDV
AKHIVDFMQQNGGLITYEDLLAYKAVWRKPLHLNWQGYELVTAPPPSSGGVAVAQWIGML
EAYDATHDLPAQNSTEYIHVMSEIGKRVFADRAEYMGDPDFVSVPVKALTDANYITQRAA
DIQPTSISDTPSVKPGLKESEDTTHFSIMDRWGNAVANTTTINLTFGSGVVVTGAGFLLN
DEMDDFSAKPGVPNFFGAVGGEANAIEPYKRMLSSMTPTLVTKDDQVVLVTGSPGGTTII
SSVTQSLLNALLYDMSAEEAVNSPRFHHQLLPKDTIRMHDGFTEATVNELKAMGYTIDNR
RFGDVHLIKRTKEGVEAASEKSGRGKSLVQPY
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcggatagctaacgtcgggtttatctcggtaatagtggcatttatttcagta
gtggcagcatgttcccatgcgccaaatccccctgttgatagtgctagcaacaatacagta
gggcttagccaacaggccgttgccatgcctgacagctacagtgccgatgctgcaatgcag
gtactccaagaaggtggtaacgcaattgacgctgctattacggcacagtttgtcttggct
gttactctacctgaggcgggcaacgtaggcggtggcggctttatgacaataaagtttgaa
gataacaccgactttttagattaccgtgaaatggcacctgaaaatgcgcatcgcgatatg
tatcttgacgagcaaggtgacgtaaaaccgtacgagtctttgtttggggctaaagcgtct
ggcattcctggtaccgttgctggtatgtgggccgcgcataaaaaatacggcacattggat
tgggagcgtctactcgcaccagccgttgatttggccgagcaaggttttgtggttcacgag
aagctggccaataacattgatcactatattgagcgtaccaaagaagcagctatcaataac
aactttagcgagtattttgcacacgctaaagcaggcactaccttcaaacagccagagcta
gcgaaaacgcttaaagctattcagcaacagggaaaggatggcttttataaaggcgatgta
gcaaagcatattgttgattttatgcagcaaaacggcggacttattacctatgaagactta
ctggcttacaaagcagtgtggcgcaaacctcttcacctaaactggcaaggttatgagctg
gtgaccgcacctcctccaagctctggtggtgttgccgttgcccagtggattggcatgcta
gaagcctatgacgcaacgcacgacttgccagcgcaaaacagtactgaatacattcacgtt
atgtctgaaataggtaagcgcgtgtttgccgaccgcgctgaatacatgggcgatcctgac
tttgttagtgttccggtaaaagcgcttactgacgctaactatattactcaacgcgcagca
gatattcagcctaccagtatttctgataccccaagcgttaagcctggtttaaaagaaagc
gaagatacaacacacttctccattatggacagatggggtaacgcggttgccaatacaacg
accatcaaccttacgtttggtagcggtgttgttgtgactggcgctggctttttgttgaat
gatgaaatggacgattttagtgctaagcctggcgtgcctaacttctttggcgcagtgggt
ggtgaggcgaatgctattgaaccttacaagcgcatgctgtcttctatgacgccaacgctg
gtcactaaagacgaccaagtggtactggtaacaggctctcctggcggcactaccattatt
tcgtcagtaactcagtcgctattgaatgccctgctttacgatatgagcgctgaagaggcc
gtgaactcaccacgttttcatcaccagctattgcccaaagacaccattcgtatgcacgac
gggtttacagaggcaacggtaaatgagcttaaagcaatgggctataccatagataaccgt
cgctttggtgatgtgcatttaattaagcgtactaaagagggtgtagaagccgcatctgaa
aaaagcggacgaggtaagagcctagtacaaccatattag

DBGET integrated database retrieval system