KEGG   Alteromonas macleodii ATCC 27126: MASE_02395Help
Entry
MASE_02395        CDS       T02246                                 

Gene name
pcm
Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
amac  Alteromonas macleodii ATCC 27126
Brite
Enzymes [BR:amac01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     MASE_02395 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 RrnaAD Methyltransf_23 Methyltransf_4 Methyltransf_11 DREV Methyltransf_32 MTS DUF938 Methyltr_RsmB-F
Motif
Other DBs
NCBI-ProteinID: AFS36041
Position
complement(537843..538478)
Genome map
AA seq 211 aa AA seqDB search
MRASRKGDALAQLLYNEGIRSQAVLNAIAGTPRESFLPDALKHKAYQNTALPIGQGQTIS
QPYIVAKMTELLLDSPNKPEKVLEIGTGSGYQTAILAQLFAKVFSVERIKSLQFQAKRRM
NQLDLHNIAMKHGDGWKGWASKGPYDAIIVTAAAASLPQDLCDQLKEGGRLIIPVGNEQQ
SLLCIDRIEGELKTSTIESVRFVPLVAGELM
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgagagcttctagaaaaggagacgcgttagcacaactgctttataacgagggaatacgt
tcgcaagcagtattgaacgccattgctggtacgccgcgggaaagctttttacccgacgcg
ctgaaacataaggcctatcaaaatacggcattgccaataggtcaaggccaaaccatttcg
cagccttatattgttgcgaaaatgacagagttgctgctagatagccctaataaacccgag
aaagtgttagaaataggcacgggttcaggttatcagaccgctatactcgcgcagcttttt
gccaaagtattcagtgttgaacgtattaaatcattgcagttccaagcgaaacgtcgaatg
aatcagctcgaccttcacaatattgcaatgaaacacggcgatggttggaaaggttgggca
tccaagggcccttacgatgccattattgtcaccgccgccgctgcaagtcttccacaggat
ctgtgcgatcagcttaaagaaggcgggcggttgattattcccgtaggtaacgagcaacaa
tcgttactatgtattgataggattgaaggtgaactaaaaacatcgaccattgaatcggtc
cgatttgttccccttgtagcaggagagctaatgtga

DBGET integrated database retrieval system