KEGG   Alteromonas macleodii ATCC 27126: MASE_03480Help
Entry
MASE_03480        CDS       T02246                                 

Definition
(GenBank) nitroreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
amac00633  Nitrotoluene degradation
amac01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:amac00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MASE_03480
Enzymes [BR:amac01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     MASE_03480
  1.-  
   1.-.-  
    1.-.-.-  
     MASE_03480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: AFS36250
Position
789212..789868
Genome map
AA seq 218 aa AA seqDB search
MSHPIIEDLNKRYTVKQYDANKRISADDLATILEALRLSASSINSQPWKFVVVESDEAKQ
RLHESFANKHQFNQHHAKEASHTILFAYDPKFTKEKFVKRVDAEVSSGHLPEDMRENFMG
AYAFAEANTDENGNNAAWTKAQVYLALGNVLHTLARLGIASTPMEGVDAELLGEQFKDEL
DGHVCEVALAMGYPDTEQDWNHGLPKARLAKEDVIAVV
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
gtgtctcatccaattattgaagatttaaataagcgttacacggttaaacagtacgatgcg
aataaacgcatttcagctgatgatctggcgacaattcttgaggcgttgagattatcagcg
tcttcaatcaactctcagccatggaaatttgtggttgttgaaagtgatgaagccaagcag
cgtttacacgaaagctttgccaacaagcatcagttcaatcagcatcacgctaaagaagca
tcgcatactattctgtttgcttatgatcctaaatttacgaaagagaaatttgtaaagcgt
gtcgatgcagaagtatcgtctggtcatttacccgaagatatgcgtgaaaacttcatgggc
gcttacgcatttgctgaagcgaacaccgatgagaacggtaacaacgcggcttggaccaaa
gcgcaagtttatctagcgctaggcaatgttcttcacacgctggcgcgtttaggcatagcg
tctacgccgatggaaggtgttgacgccgaattgcttggcgaacagtttaaagatgagcta
gacggccacgtttgcgaagtggcacttgccatgggctacccagatacagagcaagattgg
aaccatggtttaccgaaagcgcgccttgcaaaagaagatgtgatcgcggttgtgtaa

DBGET integrated database retrieval system