KEGG   Alteromonas macleodii ATCC 27126: MASE_04340Help
Entry
MASE_04340        CDS       T02246                                 

Definition
(GenBank) putative glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
amac00040  Pentose and glucuronate interconversions
amac00052  Galactose metabolism
amac00500  Starch and sucrose metabolism
amac00520  Amino sugar and nucleotide sugar metabolism
amac01100  Metabolic pathways
amac01130  Biosynthesis of antibiotics
Module
amac_M00362  Nucleotide sugar biosynthesis, prokaryotes
amac_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:amac00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MASE_04340
   00052 Galactose metabolism
    MASE_04340
   00500 Starch and sucrose metabolism
    MASE_04340
   00520 Amino sugar and nucleotide sugar metabolism
    MASE_04340
Enzymes [BR:amac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MASE_04340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD AstB
Motif
Other DBs
NCBI-ProteinID: AFS36417
Position
1003759..1004652
Genome map
AA seq 297 aa AA seqDB search
MSQVKKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVSECVAAGLKEIILVTHAS
KNSIENHFDTSFELEATLEKRVKRQLLEEVQSICPKDVTIMHIRQGVANGLGHAVLCARP
LIGDAPFAVVLPDVIIDDAASNPKKDNLADMVAKFNTSRVSQVMVEQVPDEDISKFGIAD
LDGAAIAPGESAKIHNMVEKPPRDEAPSDLAVVGRYVLSEKIWDLLEFTPPGAGGEVQLT
DAIDALMKLEQVDAYYMKGKSHDCGSKLGYMKANVEYALRHPSLGDEFKEYLASVVK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggttaaaaaagcggtaatccctgtagcgggccttgggacgagaatgctccca
gcaacgaaagctattccaaaagagatgttgccagtggttgataagccattgatccaatac
gtggtaagcgaatgtgttgctgcaggactaaaagaaattatcctagtaacgcacgcgagt
aaaaacagtattgaaaaccactttgatacctcttttgagctagaagccacactagaaaag
cgtgtaaaacgccaactgttagaagaagttcagtcaatctgtccaaaagatgtaactatc
atgcatattcgccaaggcgttgcgaatggacttggtcacgcagtactttgcgctcgacct
ctgattggcgatgcgccatttgcggtagtgttacctgacgtcattattgatgatgcagca
agtaatcctaaaaaggataaccttgcagacatggttgccaaatttaacaccagccgagta
agccaggtcatggttgagcaggttccagacgaagatatctctaaatttggtatcgcagac
ctagacggcgcggcaattgcgccaggtgagtcagcgaagattcacaacatggtagagaag
ccgcctcgcgacgaagcaccttctgaccttgccgttgtaggccgatacgttctgtcagaa
aaaatctgggatctgttagagttcacgcctccaggcgcaggtggtgaagttcagcttact
gatgctattgatgcattgatgaaacttgaacaagttgatgcctactacatgaaaggtaag
agtcacgattgcggtagtaagttggggtacatgaaagctaacgttgaatatgcgttacgt
catccatcgttaggcgacgaatttaaagaatacttagcttctgttgttaaatag

DBGET integrated database retrieval system