KEGG   Alteromonas macleodii ATCC 27126: MASE_08000Help
Entry
MASE_08000        CDS       T02246                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
amac00071  Fatty acid degradation
amac00072  Synthesis and degradation of ketone bodies
amac00280  Valine, leucine and isoleucine degradation
amac00310  Lysine degradation
amac00362  Benzoate degradation
amac00380  Tryptophan metabolism
amac00620  Pyruvate metabolism
amac00630  Glyoxylate and dicarboxylate metabolism
amac00640  Propanoate metabolism
amac00650  Butanoate metabolism
amac00900  Terpenoid backbone biosynthesis
amac01100  Metabolic pathways
amac01110  Biosynthesis of secondary metabolites
amac01120  Microbial metabolism in diverse environments
amac01130  Biosynthesis of antibiotics
amac01200  Carbon metabolism
amac01212  Fatty acid metabolism
amac02020  Two-component system
Brite
KEGG Orthology (KO) [BR:amac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MASE_08000
   00630 Glyoxylate and dicarboxylate metabolism
    MASE_08000
   00640 Propanoate metabolism
    MASE_08000
   00650 Butanoate metabolism
    MASE_08000
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MASE_08000
   00072 Synthesis and degradation of ketone bodies
    MASE_08000
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MASE_08000
   00310 Lysine degradation
    MASE_08000
   00380 Tryptophan metabolism
    MASE_08000
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MASE_08000
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MASE_08000
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MASE_08000
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amac04147]
    MASE_08000
Enzymes [BR:amac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MASE_08000
Exosome [BR:amac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MASE_08000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ChlamPMP_M CHGN
Motif
Other DBs
NCBI-ProteinID: AFS37131
Position
1874474..1875655
Genome map
AA seq 393 aa AA seqDB search
MRDAVIVSTARTPIGRAYKGALNNLPAPSLGGHAIQNAVARAGIDPASVDDVVMGAALTQ
GSGGMNIGRLAGLAGGLPVTVAGMTLDRQCSSGMYAIATAANSIRTGDTNIMVAGGLDSI
SLVQNKNMNMFRAVDPALVAKHKDIYMPMLQTAEVVGKRYNISRDVQDEYGYQSQMRTAA
AQEAGKFDDEIVPITATQALFNKETGETSEREVTLSKDEGNRPETTLEGLKALNPVIEGG
CITAGNASQLSDGASATVIMDEHSAAKGNAQPLGIYRGIAVAGCEPDEMGIGPVFAIPKL
LKQHGLTMDDIGLWELNEAFAVQVLYCRDKLGIPDELLNVNGGAISIGHPYGMSGARMVG
HALIEGKRRGAKYVVCTMCIGGGMGAAGLFEVI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgatgcagttatcgtaagtacagcacgtacgccaatcgggcgcgcttataaaggt
gcactgaacaatttaccagccccttcattaggtggccatgctattcaaaacgcagtagca
cgcgcagggatcgaccctgccagtgttgatgacgtggtaatgggcgcagcgttaacccaa
ggcagtggcggcatgaatattggccgcttggctggcctagcgggtggtttaccggtcacc
gtagcgggtatgacactcgaccgccaatgcagttctggcatgtatgccattgctaccgca
gcgaattcaattcgtacgggcgataccaacattatggttgcgggcggcttagattctatc
tctttagtgcaaaacaaaaatatgaatatgtttcgtgcagtagaccctgcactggttgct
aagcacaaagatatttatatgccaatgcttcaaactgcagaagtggtgggtaagcgctac
aacattagccgtgacgtacaagacgaatacggttaccaaagccaaatgcgcacagcagct
gctcaagaagcaggtaagtttgatgatgagattgtacctatcacagcaacgcaagcctta
tttaataaggaaacaggtgaaacctctgagcgtgaagtgaccttgtcaaaagacgaagga
aatcgcccagaaacaacgctagaggggcttaaagcgcttaacccagtgatagaaggtggt
tgtattaccgcaggtaatgcaagccagctttctgatggagccagcgcgacagtgattatg
gatgagcactcagcggcaaaaggcaatgctcaacctcttggtatttatcgcggtattgca
gtggcaggctgtgagccagatgaaatgggaattggcccagtgttcgccattcctaagcta
ttaaagcagcatggattgaccatggacgatatcggtctatgggagcttaatgaagcgttt
gcggtacaggtactttattgccgcgataagttaggcattccagacgaattattaaacgta
aacggtggtgccatttctattggtcacccatacggcatgagcggtgctcgcatggtgggt
catgcactcatcgaaggtaaacgacgcggtgcgaaatatgttgtttgcaccatgtgtatc
ggtggcggcatgggcgctgctggtctatttgaagtaatatag

DBGET integrated database retrieval system