KEGG   Alteromonas macleodii ATCC 27126: MASE_11165Help
Entry
MASE_11165        CDS       T02246                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
amac00010  Glycolysis / Gluconeogenesis
amac01100  Metabolic pathways
amac01110  Biosynthesis of secondary metabolites
amac01120  Microbial metabolism in diverse environments
amac01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:amac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MASE_11165
Enzymes [BR:amac01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     MASE_11165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AFS37756
Position
2610437..2611288
Genome map
AA seq 283 aa AA seqDB search
MPPVSSVTVSESNGLTFLDVDNAFASARISLFGGHILSYVPKSDGRERLWVSPHAYLNGE
RPIRGGIPVCWPWFSDDHGREKGALPAHGFLRTQVWKLIHSEDTESGTTITLSPSFTRAE
GFENDCNVTMVITVGETMDVALTTENTGVVPFEFNCALHTYFHVDHIQHTQITGIEGQYK
DKLDDWGLKTTPSPYTITGETDRIHVAPIKTAEIEVEGNAFTEVVSDGNDSLVVWNPWLG
AASISDMDPFGYKHMLCVETSLTQGKTLSPGASHTLKQSIVPK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgccacctgtgagttcagttaccgttagtgagtctaatggacttacctttttagacgta
gataatgcgtttgcctctgcgcgtattagcctatttggcggtcatatcttgtcatatgtg
cctaaaagcgatggcagagagcgtctttgggtaagcccccatgcttacttgaacggagag
cgacctattcgcggtggtattccggtgtgctggccttggtttagcgatgatcacggtcga
gaaaaaggtgccctccccgctcacggctttttgagaacacaagtgtggaagctgattcat
tcagaagatacagaaagcggaacaacgattacgctttcgccaagctttacccgagctgaa
gggtttgagaacgattgtaacgtgaccatggtaattacagttggtgagacgatggacgtc
gcgctaactacagaaaatacgggtgttgtaccattcgaatttaactgtgcgctacataca
tatttccacgttgaccacattcaacatacccaaataactggaattgaaggccaatataaa
gacaaacttgacgactggggattaaagacgacaccgagtccttacaccatcacaggcgaa
acggatcgcattcatgttgcgccgattaaaacggcagaaattgaagtcgaaggcaacgcg
ttcacggaagtggtatccgacggcaatgactctttggtagtgtggaacccgtggttaggc
gcagcgtctatttcagacatggacccatttggctataagcatatgttgtgcgtagaaaca
tcgctaactcagggaaagacactgtcccccggtgctagccacacactgaaacaatctatt
gttccgaagtaa

DBGET integrated database retrieval system