KEGG   Alteromonas macleodii ATCC 27126: MASE_12100Help
Entry
MASE_12100        CDS       T02246                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
amac00340  Histidine metabolism
amac01100  Metabolic pathways
amac01110  Biosynthesis of secondary metabolites
amac01230  Biosynthesis of amino acids
Module
amac_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:amac00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    MASE_12100
Enzymes [BR:amac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     MASE_12100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AFS37937
Position
2817537..2818841
Genome map
AA seq 434 aa AA seqDB search
MITWSSLSVNEKKQALARPAMANSQQLKQTVGDIIARVEKEGDEAVLDYTRKFDCPDLTS
LVLSQENIDALAAKVTPEVASAIDTAFNNIKMFHEAQMPSDIALTTTPGVKCELRFTALD
AVGLYIPGGSAPLPSTVLMLGVPALVAGCENKLLCTPPNKEQLIAPEIAYAARKCGIDKI
FLCGGAQAIAAMALGTDSVPQVDKIFGPGNSFVTEAKQQVSQRADGAAIDMPAGPSEVLV
LADEFANPEFVAADLLSQAEHGPDSQAILVSNSATLIEEAKAAVERQLATLSRAEIARPA
MENARYILADSIEQAIEASNAYAAEHLIVQIENARDYLPKIKYAGSIFLGPWSPESAGDY
ASGTNHVLPTYGYAKNYSSLGLLDFMRRYTIQELSADGMRNLGPAIMALAAAEGLDAHEQ
AVALRMQALKQGDA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgattacttggtcatctctttcggtaaatgagaaaaaacaggcgctagcccgcccggct
atggccaatagccaacagttaaagcagaccgtgggcgacattatcgcccgcgttgaaaaa
gaaggcgatgaggcagtacttgattacacacgtaaatttgactgcccagacttaactagc
cttgtactttcacaagaaaacattgatgctcttgctgcgaaggtaacgccagaggtagca
agtgctatcgatactgcgttcaacaacataaaaatgtttcacgaagcgcaaatgcctagt
gatatcgcgctaaccacaacgcctggtgttaaatgcgagctgcgcttcactgcccttgat
gcagtgggtctttatattccaggcggcagcgcgccgcttccttctaccgtattgatgcta
ggcgtacctgcattggtggcgggctgcgaaaataagctactttgtactccaccaaacaaa
gaacagcttatcgcgcctgaaattgcgtatgcggccagaaaatgcggcatcgacaagatc
ttcttgtgtggtggtgcccaagcaatcgccgctatggccttgggaacagacagcgttcct
caagtagataagatttttggcccgggtaacagctttgtgactgaagctaaacagcaagta
agccaacgtgctgatggtgcagctattgatatgccggccggcccatcagaagtgttggta
cttgctgatgagttcgcaaaccctgagtttgtagcggccgacctgctttcccaagccgag
cacggtccagactcgcaggctattttggtgtctaacagcgctacacttattgaagaagca
aaagccgcggttgaacgtcaattagcaaccctatctcgcgctgagattgcccgccctgct
atggaaaatgcgcgttatattttggctgattccattgagcaagccattgaagcaagtaac
gcctacgctgctgagcacttaattgtacaaatagagaatgcccgtgattatttgccaaaa
attaaatacgcaggctctatattcctaggcccgtggtcaccagaatctgcaggtgattac
gcgtcgggcactaaccacgtactgccaacctatggctatgctaagaattactctagcctt
ggattattagactttatgcgtcgctacactattcaagaactaagcgcagacggcatgcgt
aatttaggccctgcgattatggcacttgcagctgccgagggcttggatgcacacgaacag
gccgttgcacttcgcatgcaggcacttaagcaaggagacgcctaa

DBGET integrated database retrieval system