KEGG   Alteromonas macleodii ATCC 27126: MASE_13405Help
Entry
MASE_13405        CDS       T02246                                 

Definition
(GenBank) enoyl-CoA hydratase/carnithine racemase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
amac00071  Fatty acid degradation
amac00280  Valine, leucine and isoleucine degradation
amac00281  Geraniol degradation
amac00310  Lysine degradation
amac00360  Phenylalanine metabolism
amac00362  Benzoate degradation
amac00380  Tryptophan metabolism
amac00410  beta-Alanine metabolism
amac00627  Aminobenzoate degradation
amac00640  Propanoate metabolism
amac00650  Butanoate metabolism
amac00903  Limonene and pinene degradation
amac00930  Caprolactam degradation
amac01100  Metabolic pathways
amac01110  Biosynthesis of secondary metabolites
amac01120  Microbial metabolism in diverse environments
amac01130  Biosynthesis of antibiotics
amac01212  Fatty acid metabolism
Module
amac_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:amac00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MASE_13405
   00650 Butanoate metabolism
    MASE_13405
  Lipid metabolism
   00071 Fatty acid degradation
    MASE_13405
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MASE_13405
   00310 Lysine degradation
    MASE_13405
   00360 Phenylalanine metabolism
    MASE_13405
   00380 Tryptophan metabolism
    MASE_13405
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MASE_13405
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MASE_13405
   00281 Geraniol degradation
    MASE_13405
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MASE_13405
   00627 Aminobenzoate degradation
    MASE_13405
   00930 Caprolactam degradation
    MASE_13405
Enzymes [BR:amac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MASE_13405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 DUF4943
Motif
Other DBs
NCBI-ProteinID: AFS38191
Position
3119150..3119806
Genome map
AA seq 218 aa AA seqDB search
MAFNLAINNDIAVITFDDGKVNAVGFELIQQFNDALDEAEQNAKAVVLHGGEGKFCGGFD
LSVMKADDKAKQHELVSKGAELIVRLYSFPLPVVVAAEGHSIAMGAIMLMAADLRIGKDA
DTKYGLNETAIGMVLPPFGMELAKARLANTSQTEALLFSRIYQGSEAVKAGFLDAAVPQE
QVLATAMGYAEKLKMLPRQSFAESKIQLRKETIAKMQA
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttaatttagctattaataacgatattgctgtaatcacctttgacgacggaaaa
gttaacgccgttgggtttgagcttattcagcagtttaacgatgccttagatgaagcagag
caaaacgcaaaagcggttgtattacacggtggtgaaggcaagttttgcggcgggtttgat
ttatcggtaatgaaagccgacgacaaagcaaaacaacacgagttggtgtcaaaaggcgct
gagttaatcgtacgtctttatagcttcccactacctgtagtcgttgctgcagaaggtcac
agcattgcaatgggcgcaattatgcttatggctgctgacctacgcattggtaaagacgca
gatactaagtatggtcttaatgaaaccgccattggtatggtactgccgcctttcggtatg
gaactagccaaagctagattagcaaatacgtctcaaactgaagctttacttttctcacgt
atttatcaaggcagtgaagcggtaaaagcgggctttttagatgctgcagtacctcaagag
caggtattagcgacagccatgggttatgcagaaaagttgaagatgttgcctagacagtct
tttgctgagtctaaaattcagttgcgtaaagagacaatagccaagatgcaagcctag

DBGET integrated database retrieval system