KEGG   Alteromonas macleodii ATCC 27126: MASE_16785Help
Entry
MASE_16785        CDS       T02246                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
amac00051  Fructose and mannose metabolism
amac00520  Amino sugar and nucleotide sugar metabolism
amac01100  Metabolic pathways
amac01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MASE_16785
   00520 Amino sugar and nucleotide sugar metabolism
    MASE_16785
Enzymes [BR:amac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     MASE_16785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 AraC_binding
Motif
Other DBs
NCBI-ProteinID: AFS38849
Position
complement(3944019..3945425)
Genome map
AA seq 468 aa AA seqDB search
MKPVVLAGGSGSRLWPKSRAALPKQFLSLTSDSTMLQDTITRLKGTPAQNPIFICNDAHR
FLVAEQLRQKDIQHGGILLEPVGRNTAPAIALAALHATINGEDPVLLVLAADHLIKDNQA
FHTAIAKAEKLAEQGKLVTFGIVPDQPHTGYGYIKAGKQAGDGFEVAQFVEKPALETAKE
YVDSGSYYWNSGMFMFKASRYLEELEKYNPEMLDVCKRAIDTETPDLDFIRVDHDIFATC
PDDSIDYAVMEKTDSAAMVPLDAGWSDVGSWSSLWETAEKDENGNATVGDTILENTKNSY
VNAEQRLVSVIGLEDVIVVETKDAVMVAHKDDAQSIKTVVNKLKAEHRPEFEFHREVFRP
WGSYDSIDSGARFQVKRITVKPGEKLSVQMHHHRAEHWIVVSGSANVTINEETQLVTENE
SVYIPIGAVHALENPGKIPLELIEVQSGAYLGEDDIVRFSDRYGRVAK
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccagtagtattagctggcggctcaggtagtcgcttatggcctaaatctcgtgca
gcgcttccaaagcagtttttgtctcttacatcagacagcactatgctgcaagacacgatc
acacgcttaaaaggcacaccagctcaaaacccaatattcatttgtaacgatgcccatcgc
tttttagttgccgaacagcttcgccaaaaagatatccaacatggcggtattcttttagag
cctgttggtcgtaatacggcaccggcaattgcattagcggcgcttcatgccactattaac
ggcgaagaccctgttcttcttgtcttggccgctgaccaccttattaaagataaccaagcg
tttcacactgctattgctaaagccgaaaagcttgcagagcagggtaaacttgttactttc
ggtattgttccagaccagccacatacagggtatggttatatcaaagctggaaagcaagcg
ggcgatggatttgaagttgcacagtttgtagaaaagcctgctttggaaactgcaaaagag
tatgtagattctggcagttattactggaatagcggcatgtttatgtttaaagcaagccgc
tatttggaagaactagaaaaatataaccctgaaatgctagacgtgtgtaagcgtgctatc
gatacagaaacaccagatctagatttcatccgtgttgaccacgacatttttgcgacttgc
ccagacgattcaatcgattatgcggtgatggaaaaaacggatagcgcagctatggttcca
ttagacgcaggttggagcgatgtaggtagctggtcttcgctatgggaaactgctgaaaaa
gacgaaaacggcaatgctactgtaggcgatactatcctagaaaacaccaaaaatagttac
gtaaatgctgaacagcgtttggtttctgttatagggctagaagacgttatcgtagtagaa
accaaagatgccgttatggtagcccacaaggacgatgcgcaaagcattaaaacggtcgta
aacaaacttaaagcagagcatcgcccagagtttgaattccaccgtgaagtattccgccca
tggggaagttacgactcgatcgacagcggtgctcgtttccaagtaaaacgcattacagtt
aagccaggtgaaaagctatcggttcaaatgcaccaccatcgtgctgaacactggattgta
gtctctggtagtgcaaacgtgactatcaatgaagaaacacaattagtaacagaaaacgag
tcggtatacattcctattggtgcagtacatgcattagaaaacccaggaaaaatcccacta
gaacttattgaagttcagtcaggcgcatatctcggtgaagacgatattgtacgtttttct
gataggtatgggcgtgtagccaaataa

DBGET integrated database retrieval system