KEGG   Alteromonas mediterranea UM4b: I636_08570Help
Entry
I636_08570        CDS       T02723                                 

Definition
(GenBank) acetyl-CoA acetyltransferase with thiolase domain
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
amad  Alteromonas mediterranea UM4b
Pathway
amad00071  Fatty acid degradation
amad00072  Synthesis and degradation of ketone bodies
amad00280  Valine, leucine and isoleucine degradation
amad00310  Lysine degradation
amad00362  Benzoate degradation
amad00380  Tryptophan metabolism
amad00620  Pyruvate metabolism
amad00630  Glyoxylate and dicarboxylate metabolism
amad00640  Propanoate metabolism
amad00650  Butanoate metabolism
amad00900  Terpenoid backbone biosynthesis
amad01100  Metabolic pathways
amad01110  Biosynthesis of secondary metabolites
amad01120  Microbial metabolism in diverse environments
amad01130  Biosynthesis of antibiotics
amad01200  Carbon metabolism
amad01212  Fatty acid metabolism
amad02020  Two-component system
Brite
KEGG Orthology (KO) [BR:amad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    I636_08570
   00630 Glyoxylate and dicarboxylate metabolism
    I636_08570
   00640 Propanoate metabolism
    I636_08570
   00650 Butanoate metabolism
    I636_08570
  09103 Lipid metabolism
   00071 Fatty acid degradation
    I636_08570
   00072 Synthesis and degradation of ketone bodies
    I636_08570
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    I636_08570
   00310 Lysine degradation
    I636_08570
   00380 Tryptophan metabolism
    I636_08570
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    I636_08570
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    I636_08570
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    I636_08570
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amad04147]
    I636_08570
Enzymes [BR:amad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     I636_08570
Exosome [BR:amad04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   I636_08570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGQ01568
Position
1908220..1909395
Genome map
AA seq 391 aa AA seqDB search
MSNESVVIVAAKRTPMGGFNGSLSSLAATKLGEIAIKAACDEVDVSVIDEVIMGCVLPAG
LGQSPARQASIGAGLPLSAGVTTINKVCGSGLKAVMMAHDLIKAGSASAVVAGGMESMSN
APYMLPKARTGYRMGHGQVIDHMMLDGLENAYDGKAMGCFAQDTADEENIGRGEMDEFAL
SSLSKAHEAINSGTFNDEIAPVTVSSRKGDTVVDTDEGPGSARPEKIPTLRPAFKKDGTV
TAANSSSISDGAAALVVMSESKAKALGLTPLAKVVAHATNSIEPENFTVAPVGAMEKVLD
KAGWTKEDVDLFEINEAFAMVTMLAIKKLGLDESKVNVKGGACALGHPIGASGARILVTL
LHALKQSNGRKGIASLCIGGGEGVALAVEML
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatgaatcagtagtgatagtcgcggcgaaacgtacacctatgggtggttttaac
ggtagcttgtcttctctcgctgcgacaaagcttggagaaattgcgataaaagctgcgtgt
gatgaggtggatgtctctgtaattgacgaggtcattatggggtgtgttttaccggcgggg
ttagggcagtctcctgctcgacaagcgtcaataggggcggggcttccgctaagtgccggt
gttaccactatcaacaaagtctgtggttcaggcttaaaagcagtcatgatggcccatgat
cttatcaaagcaggcagcgcctctgcagtggtagctggcggtatggaaagtatgagtaac
gcgccatacatgttaccaaaagcgcgaacgggttatcgcatggggcatggccaagttatt
gatcacatgatgctagacggccttgagaatgcttacgacggtaaagcaatggggtgcttt
gctcaagataccgctgatgaagagaatattggccgcggtgaaatggatgaatttgcatta
agttcattgtctaaagcgcatgaagcaataaatagcggcacgttcaacgacgaaattgca
ccagtaactgtatcttcacgtaaaggtgatacagtggtggatactgatgaaggcccgggt
tctgctcgacctgaaaagatccccacactccgcccagcctttaaaaaagacggtacggta
acggcagcgaactctagctctatctctgacggtgcagcagcacttgttgttatgagcgaa
agcaaagctaaagcccttggattgacaccattagcaaaagtggtagctcacgctacgaac
tcaatagagcccgagaattttacggttgcaccggtaggcgcaatggaaaaagtgttagac
aaagctggttggacaaaagaagacgtagatctctttgaaatcaacgaagcttttgccatg
gtaactatgctggcgattaaaaagctagggcttgatgaaagcaaagtgaacgtaaagggc
ggggcatgcgcattaggccatcccattggcgcttctggcgcacgcatccttgtaacactt
cttcatgcacttaaacaaagcaatggtcgtaaaggtatagcatctttgtgtattggcggt
ggagaaggcgttgctcttgctgttgagatgctttaa

DBGET integrated database retrieval system