KEGG   Alteromonas mediterranea U7: I876_08365Help
Entry
I876_08365        CDS       T02721                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
amae  Alteromonas mediterranea U7
Pathway
amae00071  Fatty acid degradation
amae00072  Synthesis and degradation of ketone bodies
amae00280  Valine, leucine and isoleucine degradation
amae00310  Lysine degradation
amae00362  Benzoate degradation
amae00380  Tryptophan metabolism
amae00620  Pyruvate metabolism
amae00630  Glyoxylate and dicarboxylate metabolism
amae00640  Propanoate metabolism
amae00650  Butanoate metabolism
amae00900  Terpenoid backbone biosynthesis
amae01100  Metabolic pathways
amae01110  Biosynthesis of secondary metabolites
amae01120  Microbial metabolism in diverse environments
amae01130  Biosynthesis of antibiotics
amae01200  Carbon metabolism
amae01212  Fatty acid metabolism
amae02020  Two-component system
Brite
KEGG Orthology (KO) [BR:amae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    I876_08365
   00630 Glyoxylate and dicarboxylate metabolism
    I876_08365
   00640 Propanoate metabolism
    I876_08365
   00650 Butanoate metabolism
    I876_08365
  09103 Lipid metabolism
   00071 Fatty acid degradation
    I876_08365
   00072 Synthesis and degradation of ketone bodies
    I876_08365
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    I876_08365
   00310 Lysine degradation
    I876_08365
   00380 Tryptophan metabolism
    I876_08365
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    I876_08365
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    I876_08365
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    I876_08365
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amae04147]
    I876_08365
Enzymes [BR:amae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     I876_08365
Exosome [BR:amae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   I876_08365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ChlamPMP_M CHGN
Motif
Other DBs
NCBI-ProteinID: AGP89536
Position
1918329..1919510
Genome map
AA seq 393 aa AA seqDB search
MRDAVIVSTARTPIGRAYKGALNNLPAPSLGGHAIENAVSRAGIDPASVDDVIMGAALTQ
GSGGMNIGRLAGLAGGLPVTVAGMTLDRQCSSGMYAIATAANAIRTGDTNIMVAGGLDSI
SLVQNKNMNMFRAVDPALVAKHKDIYMPMLQTAEVVGKRYNISRDVQDEYGYQSQMRTAA
AQEAGKFDDEIVPITAVQAVFNKETGETSEREVTLSKDEGNRPETTLEGLKALNPVIEGG
CITAGNASQLSDGASATVIMDEQSAAKGSAQPIGIYRGIAVAGCEPDEMGIGPVFAIPKL
LKQHGLTMDDIGLWELNEAFAVQVLYCRDKLGIPDELLNVNGGAISIGHPYGMSGARMVG
HALIEGKRRGAKYVVCTMCIGGGMGAAGLFEVI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgatgcagtaattgtaagtacagcacgtacaccaataggccgtgcctataaaggc
gcactaaacaacttacccgcgccgtcgttaggtggtcatgccattgaaaatgcggtatct
cgtgcgggtattgaccctgctagcgtagatgacgtcatcatgggcgcagcgctcacacaa
ggcagcggtggtatgaacatcggccggttagccgggcttgccggcggccttcctgttacg
gttgcgggtatgacccttgaccgtcaatgtagttcaggtatgtacgccatcgctacagca
gcaaatgctattcgtactggcgataccaacattatggtagccggtggtttagattctatt
tcactggtacaaaacaagaacatgaatatgttccgtgccgttgaccctgcacttgttgct
aagcacaaagatatctacatgccgatgcttcaaaccgctgaagtggtaggcaagcgttat
aacattagccgcgatgtacaagatgagtacggctaccaaagtcaaatgcgcacagcagca
gcgcaagaggccggtaagtttgacgacgaaattgtacctattacagcagttcaagcggtg
ttcaataaagaaacgggtgaaacctctgagcgcgaagtcaccttgtctaaagatgaaggt
aatcgcccagaaactactcttgaaggtttgaaagcgttaaaccctgttattgaaggcggc
tgcattacagctggcaacgcgagccagctttcagacggcgcaagtgcaacagttattatg
gatgagcagtcagcagcgaaaggcagtgctcagccaattggtatttatcgcggtattgca
gtggcaggctgtgaacctgatgaaatgggaattggcccggtattcgccattcctaagcta
ttaaagcagcatggattaaccatggacgatatcggtctatgggaacttaacgaagcattt
gcagtacaggtactctactgccgcgacaagttaggtattccagacgaattattaaatgta
aacggcggtgccatttctattggtcacccatacggcatgagcggtgctcgcatggtgggt
cacgcactcatcgaaggtaaacgacgtggtgcgaaatatgtagtttgcaccatgtgtatc
ggtggcggcatgggcgctgctggtctatttgaagttatatag

DBGET integrated database retrieval system