KEGG   Alteromonas mediterranea U7: I876_12120Help
Entry
I876_12120        CDS       T02721                                 

Gene name
metG
Definition
(GenBank) methionyl-tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
amae  Alteromonas mediterranea U7
Pathway
amae00450  Selenocompound metabolism
amae00970  Aminoacyl-tRNA biosynthesis
amae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amae00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    I876_12120 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    I876_12120 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:amae01007]
    I876_12120 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:amae03016]
    I876_12120 (metG)
Enzymes [BR:amae01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     I876_12120 (metG)
Amino acid related enzymes [BR:amae01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   I876_12120 (metG)
Transfer RNA biogenesis [BR:amae03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    I876_12120 (metG)
 Prokaryotic type
   Other AARSs
    I876_12120 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f DZR DALR_1
Motif
Other DBs
NCBI-ProteinID: AGP90273
Position
2745864..2747891
Genome map
AA seq 675 aa AA seqDB search
MSEKRRILVTSALPYANGSIHLGHLLEHIQTDIWTRFQRLRGNECYSVCADDAHGTPVML
KAQELGITPEEMVARTRAEHHQDLVDFHVNYDNYYVTHSPENKAFCEEIYTRLDNAGYIS
KRTINQLFDPEKEMFLPDRFVKGTCPSCGAEDQNGDSCDVCGATYSPTEVKNPRSVVSGA
TPVLRESEHFFFDLPKFEGMLKEWIRSGALQEEMANKLQEWFTEGLQQWDISRDAPYFGF
EIPGAPNKFFYVWVDAPVGYMASFKNFCDQNNLEFDDFWKADSEAELYHFIGKDITYFHC
LFWPAMLEGAGYRKPTGVNIHGFVTVNGAKMSKSRGTFIKGRTYLDHLNPEYLRYYFASK
LGDGVTDIDLNFTDFAQKVNSDLVGKVVNIASRCASFITKRFDGKLSDNVIEPELIAEFQ
NASESIAALFEKRKYHQAVREIMALADKANQFIDNNAPWVTIKDETKQQFTHDVCSLGIN
MFRLLVIYLKPVLPVLAEKAEAFLNDKFDWNSLQTLLKGHAINKFKPMMQRVEMEKIDAM
VEDSKESLAPAAPAIDPDSPLAKDPISDTISFDDFAKVDLRIARIANAEHVEKADKLLRL
ELDLGGETKQVFAGIKSAYSPEALIGKHTVMVANLAPRKMRFGMSEGMVLAAGPGGDELY
ILEPHEGAKPGMRVK
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaaacgccgaattctggtaaccagtgcgttgccatacgcaaatggctctatt
cacttaggtcatttgctagaacacattcaaaccgacatctggactcgttttcagcgcctt
cgcggaaacgaatgttacagtgtttgcgccgacgatgcacacggtacgccggttatgctt
aaagcccaagagcttggcattacgccagaagaaatggtggctagaacccgtgctgaacac
catcaagaccttgttgattttcatgttaactacgacaattactatgtaactcattcgcca
gaaaacaaggcgttctgtgaagaaatttacactcgtttggataacgcaggttacatcagc
aagcgaactattaaccaattgttcgaccctgaaaaagaaatgttcttaccggatcgtttc
gttaagggcacatgcccaagttgtggcgcagaagaccaaaacggcgacagctgtgacgta
tgtggcgcaacgtatagcccgactgaagttaagaacccgcgaagcgttgtttctggcgct
acaccggtactacgtgagtctgagcacttcttctttgacctgccaaagtttgagggcatg
ttaaaagagtggatccgctcaggtgcccttcaagaagaaatggcaaacaagctacaagaa
tggttcaccgaaggtcttcagcagtgggacattagccgtgatgcgccttacttcggcttt
gaaattccaggtgcgccgaacaagttcttctacgtgtgggtagatgcgcctgttggctac
atggctagtttcaaaaacttctgcgaccagaacaacctagagtttgatgatttctggaag
gccgactcagaagctgagctttaccactttatcggtaaagacattacttatttccactgc
cttttctggcctgccatgctagaaggtgcgggataccgtaagcccactggcgtaaacatt
cacggtttcgtaaccgtaaacggtgcgaaaatgtcaaagtcgcgcggtacctttattaaa
ggccgcacctacttagaccacttaaacccagaatacttgcgctactactttgcctctaag
ctgggtgacggtgttaccgacatcgaccttaactttactgacttcgcacaaaaagtgaat
tcagacctggtaggtaaagtggttaacattgcaagccgctgtgcaagctttatcaccaag
cgtttcgacggaaaactgtctgacaacgtaattgagccagaacttattgctgagttccaa
aacgcatcagaaagcattgctgccctttttgaaaagcgtaagtatcaccaagctgtgcgc
gaaattatggctcttgccgacaaagcgaaccagttcattgataacaatgcgccttgggtt
accattaaagacgagactaagcagcagttcacacacgatgtgtgctcgctaggtatcaac
atgttccgtctgttggttatttacttaaagcctgtactgccagtactggcagaaaaagca
gaagcattcttaaacgacaagttcgactggaattcactgcaaaccctattgaaaggccac
gccatcaacaaatttaagccaatgatgcaacgtgtagaaatggagaaaatcgacgccatg
gttgaagattcaaaagaaagcctagcgccagcagcaccggctatcgacccagacagcccg
cttgctaaagaccctatcagcgacactatctcgtttgatgatttcgcaaaggtagattta
cgtattgcacgcattgctaacgccgagcacgtagaaaaagcagacaaacttttacgttta
gagctggatttaggcggcgaaactaagcaagtatttgcaggtattaagtcggcctactcg
cctgaagcgcttatcggtaagcacacggtaatggtggctaacctagcgccccgcaaaatg
cgctttgggatgagtgaaggcatggtattagccgcgggccctggcggcgacgagctatac
attcttgagccacacgaaggtgcaaagccgggtatgcgtgttaaataa

DBGET integrated database retrieval system