KEGG   Alteromonas mediterranea MED64: I533_08070Help
Entry
I533_08070        CDS       T02958                                 

Definition
(GenBank) acetyl-CoA acetyltransferase with thiolase domain
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
amag  Alteromonas mediterranea MED64
Pathway
amag00071  Fatty acid degradation
amag00072  Synthesis and degradation of ketone bodies
amag00280  Valine, leucine and isoleucine degradation
amag00310  Lysine degradation
amag00362  Benzoate degradation
amag00380  Tryptophan metabolism
amag00620  Pyruvate metabolism
amag00630  Glyoxylate and dicarboxylate metabolism
amag00640  Propanoate metabolism
amag00650  Butanoate metabolism
amag00900  Terpenoid backbone biosynthesis
amag01100  Metabolic pathways
amag01110  Biosynthesis of secondary metabolites
amag01120  Microbial metabolism in diverse environments
amag01130  Biosynthesis of antibiotics
amag01200  Carbon metabolism
amag01212  Fatty acid metabolism
amag02020  Two-component system
Brite
KEGG Orthology (KO) [BR:amag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    I533_08070
   00630 Glyoxylate and dicarboxylate metabolism
    I533_08070
   00640 Propanoate metabolism
    I533_08070
   00650 Butanoate metabolism
    I533_08070
  09103 Lipid metabolism
   00071 Fatty acid degradation
    I533_08070
   00072 Synthesis and degradation of ketone bodies
    I533_08070
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    I533_08070
   00310 Lysine degradation
    I533_08070
   00380 Tryptophan metabolism
    I533_08070
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    I533_08070
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    I533_08070
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    I533_08070
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amag04147]
    I533_08070
Enzymes [BR:amag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     I533_08070
Exosome [BR:amag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   I533_08070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGP81590
Position
1799928..1801103
Genome map
AA seq 391 aa AA seqDB search
MSNESVVIVAAKRTPMGGFNGSLSSLAATKLGEIAIKAACDEVDVSVIDEVIMGCVLPAG
LGQSPARQASIGAGLPLSAGVTTINKVCGSGLKAVMMAHDLIKAGSASAVVAGGMESMSN
APYMLPKARTGYRMGHGQVIDHMMLDGLENAYDGKAMGCFAQDTADEENIGRGEMDEFAL
SSLSKAHEAINSGTFNDEIAPVTVSSRKGDTVVDTDEGPGSARPEKIPTLRPAFKKDGTV
TAANSSSISDGAAALVVMSESKAKALGLAPLAKVVAHATNSIEPENFTVAPVGAMEKVLD
KAGWTKEDVDLFEINEAFAMVTMLAIKKLGLDESKVNVKGGACALGHPIGASGARILVTL
LHALKQSNGRKGIASLCIGGGEGVALAVEML
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatgaatcagtagtgatagtcgcggcgaaacgtacacctatgggtggttttaac
ggtagcttgtcttctctcgctgcgacaaagcttggagaaattgcgataaaagctgcgtgt
gatgaggtggatgtctctgtaattgacgaggtcattatggggtgtgttttaccggctggg
ttagggcagtctcctgcgcgacaagcgtcaataggggcggggcttccgctaagtgccggt
gttaccactatcaataaagtctgtggttcaggcttaaaagcagtcatgatggcccatgat
cttatcaaagcaggcagcgcctctgcggtggtagctggcggtatggaaagtatgagtaac
gcgccatacatgttgccaaaagcgcgaacgggttatcgcatggggcatggccaagttatt
gatcacatgatgctagacggccttgagaatgcttacgacggtaaagcaatggggtgcttt
gctcaagatactgctgatgaagagaatattggccgcggtgaaatggatgaatttgcatta
agttcattgtctaaagcgcatgaagcaataaatagcggcacgttcaacgacgaaattgca
ccagtaactgtatcttcacgtaaaggtgatacagtggtggatactgatgaaggcccgggc
tctgctcgacctgaaaagatccccacactccgcccagcctttaaaaaagacggtacggta
acggcagcgaactctagctctatctctgacggtgcagcagcacttgttgttatgagcgaa
agcaaagctaaagcccttggattggcgccattagcaaaagtggtagctcatgctacgaac
tcaatagagcccgagaattttacggttgcaccggtaggcgcaatggaaaaagtgttagac
aaagctggttggacaaaagaagacgtagatctctttgaaatcaacgaagcttttgccatg
gtaactatgctggcgattaaaaagctagggcttgatgaaagcaaagtgaacgtaaagggc
ggggcatgcgcattaggccatcccattggcgcttctggcgcacgcatccttgtaacactt
cttcatgcacttaaacaaagcaatggtcgtaaaggtatagcatcgttgtgtattggcggt
ggagaaggcgttgctcttgctgttgagatgctttaa

DBGET integrated database retrieval system