KEGG   Alteromonas mediterranea MED64: I533_14555Help
Entry
I533_14555        CDS       T02958                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
amag  Alteromonas mediterranea MED64
Pathway
amag00010  Glycolysis / Gluconeogenesis
amag00071  Fatty acid degradation
amag00350  Tyrosine metabolism
amag00625  Chloroalkane and chloroalkene degradation
amag00626  Naphthalene degradation
amag00680  Methane metabolism
amag01100  Metabolic pathways
amag01110  Biosynthesis of secondary metabolites
amag01120  Microbial metabolism in diverse environments
amag01130  Biosynthesis of antibiotics
amag01200  Carbon metabolism
amag01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:amag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    I533_14555
  09102 Energy metabolism
   00680 Methane metabolism
    I533_14555
  09103 Lipid metabolism
   00071 Fatty acid degradation
    I533_14555
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    I533_14555
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    I533_14555
   00626 Naphthalene degradation
    I533_14555
Enzymes [BR:amag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     I533_14555
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     I533_14555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AGP82871
Position
3302209..3303366
Genome map
AA seq 385 aa AA seqDB search
MASFKDSLQEGQTHIKSKAAVAWAAGEPLKMEEVDVELPKKGEVLVRIVATGVCHTDAFT
LSGDDPEGVFPSILGHEGGGIVEMVGEGVTSVNVGDHVIPLYTAECGECKFCKSGKTNLC
QAVRETQGKGLMPDGTSRFSKDGEPIYHYMGCSTFSEYTVLPEISLAKVNKNAPLDEVCL
LGCGVTTGMGAVLKTAKVQEGDTVAIFGLGGIGLSAIIGARMAGAGRIIGIDINESKFDL
AKQLGATDVVNPKNFDKPIQEVIVEMTDGGVDYSFECIGNVNVMRSALECCHKGWGESVI
IGVAGAGQEISTRPFQLVTGRVWRGSAFGGVKGRSELPGIVEQYLNGDFGLQEFITHTMG
LDEINDAFDLMHKGESIRSVVHMDK
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgttcaaagattcattgcaagaaggtcaaacccacattaagtctaaagccgcc
gtagcctgggccgcgggtgagccgttaaaaatggaggaagttgacgtagagctgcctaaa
aaaggtgaagttctcgttcggatcgttgctactggcgtatgccacactgacgcgtttacc
ctttcgggtgacgatccagaaggcgtattcccttcaattctgggtcacgagggtggcggt
atcgttgaaatggtcggtgaaggtgttactagtgtaaacgttggcgatcatgttattcca
ctttataccgctgagtgtggcgagtgtaagttctgtaaatcaggcaaaactaacctttgc
caagcggtacgcgaaacccaaggtaaaggcctaatgccagacggcacaagccgtttctct
aaagatggcgagccaatttatcactatatgggctgttcaacgttttctgagtacacagtt
ctacctgaaatatcgctagctaaagtaaacaaaaatgccccgctggacgaagtttgccta
ttgggttgtggtgtaactacaggtatgggtgcagtacttaaaacggctaaggttcaagaa
ggtgacacggttgctatctttggtttaggcggcatcggtttatcagccattatcggcgca
cgtatggcaggcgcgggtcgcattattggtattgatatcaacgaaagtaaattcgaccta
gccaaacagcttggcgcaactgatgtagtaaaccctaagaatttcgacaagcctattcag
gaagtcattgttgaaatgaccgacggtggcgttgactactcgtttgagtgtatcggtaat
gtgaacgtaatgcgctctgcccttgagtgctgccacaaaggctggggcgagtcagtaatt
atcggtgtagccggtgcgggccaagaaatttcaactcgtccatttcagctagtgacaggt
cgtgtatggcgcggctctgcctttggtggtgtaaaaggtcgttcagagcttcctggcatt
gttgaacaataccttaatggtgactttggtcttcaagagttcattactcacaccatgggc
cttgatgaaatcaatgacgcctttgacttaatgcacaaaggcgaaagtattcgctctgtt
gtgcatatggataagtaa

DBGET integrated database retrieval system