KEGG   Alteromonas mediterranea MED64: I533_18390Help
Entry
I533_18390        CDS       T02958                                 

Definition
(GenBank) divalent cation tolerance protein
  KO
K03926  periplasmic divalent cation tolerance protein
Organism
amag  Alteromonas mediterranea MED64
Brite
KEGG Orthology (KO) [BR:amag00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    I533_18390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CutA1
Motif
Other DBs
NCBI-ProteinID: AGP83627
Position
4195143..4195457
Genome map
AA seq 104 aa AA seqDB search
MTIKLVLCTTPDEKSAQDIATALVKSKLAACVNIIKGIQSVYEWQGKVEVDAECQLLIKT
NTQNVLQAFEKVSEIHPYDVPEWLELNAEASSAYGQWLQTTLQQ
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgacaattaaacttgtgttgtgtaccacacccgatgaaaagtcagcgcaagacattgct
actgcacttgtaaagagtaagcttgcggcatgtgtgaacataattaaaggcattcagtct
gtttacgaatggcagggcaaggtagaagttgatgcggaatgccagctgttaattaaaacc
aatacccaaaacgtattgcaggcatttgaaaaagtgagtgaaatacacccttatgacgtg
cctgaatggttggagctaaatgcagaagcaagcagcgcatatggccaatggttgcaaacg
acactacaacaataa

DBGET integrated database retrieval system