KEGG   Aquitalea magnusonii: DLM_0550Help
Entry
DLM_0550          CDS       T05698                                 

Definition
(GenBank) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
amah  Aquitalea magnusonii
Pathway
amah00020  Citrate cycle (TCA cycle)
amah00620  Pyruvate metabolism
amah00650  Butanoate metabolism
amah01100  Metabolic pathways
amah01110  Biosynthesis of secondary metabolites
amah01120  Microbial metabolism in diverse environments
amah01130  Biosynthesis of antibiotics
amah01200  Carbon metabolism
Module
amah_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amah_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:amah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DLM_0550
   00620 Pyruvate metabolism
    DLM_0550
   00650 Butanoate metabolism
    DLM_0550
Enzymes [BR:amah01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     DLM_0550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans
Motif
Other DBs
NCBI-ProteinID: BBF84211
UniProt: A0A3G9GDA7
Position
556124..557740
Genome map
AA seq 538 aa AA seqDB search
MQSWQPQTSRLYQTGATLDKTPGRNRPEIAREQQVEQRIHHAGLAGKIMSAEEAATHIQP
GMTVGMSGFTGSGYPKAVPLALAGRIEAAQGRGEKFALRVLTGASTAPELDGALAKAGGI
DFRLPYQSDPELRARINRGEIDYMDVHLGQVAQYTWFGFLGKIDLAVVEVAGILPDGRLI
PSTSIGNNKTWLDLADKVILEVNSTQPLGLDGMHDIYYGTALPPNRQPIPLTQAGDHIGE
PYLRVDPAKVVAVVKTHAPDRLGRFTPPDETSQRIAGHLVEFLKHEIRMGRLPENLLPLQ
SGVGNIANAVLGGLRDGGFSNLTAFTEVIQDGMLDLIRTDTIRMASATALSLSPEGVQEF
ARNIDHYRERIVLRPQEISNHAELVRRLGCIGINGMVEADLYGNVNSTHVAGTSIINGIG
GSGDFARNGFLSCFVTPSTAKNGAISCIVPMVSHVDHTEHDVCIIVTEQGLADLRGLSPK
QRARTVIANCAHPDYRPLLQDYFDRACRDSKGKHTPHLLGEALSWHERLVEQGSMRPN
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagttggcaaccgcaaacaagccggctctatcagaccggcgcaacgctcgataaa
acaccaggccgcaacaggccggaaattgcaagggaacaacaagtggaacaacgcattcac
catgccggactggcagggaaaatcatgtcggctgaggaggccgccacacacatccagcca
ggcatgaccgtgggcatgagcgggtttaccggctcgggctaccccaaggcagtgccgctg
gcgctggctggccgtattgaagcagcgcagggacgcggcgagaagttcgccttgcgtgtg
ctcaccggggcctccaccgcgccagagctggatggcgcactggccaaggccggtggcatt
gattttcgcctgccttaccagtcagacccggagctgcgcgcgcgcatcaaccgtggcgaa
atcgactatatggatgtgcatctgggccaggtggcgcagtacacctggtttggctttctg
ggcaagatcgacctggcggtggtggaagtggcgggcatcctgccggatggccggctgatt
ccgtccacctccatcggtaataacaagacctggctggacctggccgacaaggtgattctg
gaagtcaacagcacccagccgctggggctggatggcatgcatgacatctattacggcacc
gcactgccacccaaccgccagccgattccgttgacccaggcgggcgaccacattggcgaa
ccctatctgcgggtggacccggccaaggtggtggcggtggtgaaaacccatgcgccggac
cgcctgggccgctttaccccgccggacgaaaccagccagcgcattgccgggcatctggtg
gaattcctcaagcatgaaatcaggatgggccgtttgccggagaacctgctgccgctgcaa
tccggcgtcggcaatattgccaatgcggtgctgggcggcctgcgtgatggtggtttcagc
aatctgaccgcctttaccgaggtgattcaggacggcatgctggatttgatccgcaccgac
accatccgcatggcctcggccactgcgctgtcgctcagcccggaaggggtgcaggagttt
gcccgcaatatcgaccactaccgcgagcgcatcgtgctgcggccgcaggaaatctccaat
catgccgaactggtgcgccgcctgggctgcatcggcatcaatggcatggtggaggccgac
ttgtacggcaacgtcaattccacccatgtggccggcacctccatcatcaacggcattggc
ggttctggtgattttgcccgcaatggctttttgtcctgctttgtcacgcccagtacggcc
aagaacggggcgatttcctgcatcgtgcccatggtcagtcatgtcgaccacaccgagcac
gacgtctgcatcatcgtcaccgaacagggcctggccgacttgcgcggcctgtcgcccaaa
cagcgtgcgcgcacggtgattgccaattgtgcccacccggactaccgcccgctgctgcag
gattacttcgaccgcgcctgccgcgacagcaagggcaagcacactccgcatctgctgggt
gaagcactgtcctggcatgagcggctggtggagcagggcagcatgcggcccaactga

DBGET integrated database retrieval system