KEGG   Aquitalea magnusonii: DLM_1000Help
Entry
DLM_1000          CDS       T05698                                 

Definition
(GenBank) aldehyde dehydrogenase A
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
amah  Aquitalea magnusonii
Pathway
amah00620  Pyruvate metabolism
amah00630  Glyoxylate and dicarboxylate metabolism
amah01100  Metabolic pathways
amah01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:amah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DLM_1000
   00630 Glyoxylate and dicarboxylate metabolism
    DLM_1000
Enzymes [BR:amah01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     DLM_1000
    1.2.1.22  lactaldehyde dehydrogenase
     DLM_1000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: BBF84640
UniProt: A0A3G9G9N3
Position
1035101..1036525
Genome map
AA seq 474 aa AA seqDB search
MQCYQNFINNSFIQPESDVSFSVVDPATGQPRAQVSAATTAEALSAVEAATAAQKGWAAL
PACERAQYLHKLAEALQARSSQIGAALADESGKSLSDAMAEAGYAAEITRYHAEWARRIE
GEVIPSDNPQENLLLMREAIGVVVCLIPFNFPVYTLLRKIAPALITGNTVVVRPSNNTPC
SAFEIAHAVLDAGLPAGVVNILTMSHAVAETVCTHPKVGMITLTGSVGAGRKVLEYSQVN
IARSSLELGGKTPAIIEPDAKLVQAANDIVASALSHCGQLCTSVERVYVQDSVYEDFVRL
LKERFSVRQYGNRARHPNYMGPLVNATTRLNIQQMVERAVDDGAVLETGGFIPQGPGFFY
PPTLLTQCRQEMEIVQEEIFGPVLCVLKYSTAEEALLLANDHQFGLASVLYTENYRTAMR
FANHIEAGELYVNRTPADPYQGYHAGWKRSGLGGDDGKHGMLEFTQTRLVVLKY
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgctatcagaatttcatcaacaacagctttatccagcccgaaagcgatgtcagt
ttcagcgtggtagaccctgccaccggccagcctcgtgcgcaggtatccgctgccaccact
gccgaagcgctgtcggcagttgaggcggcaacggcagcccaaaaaggctgggctgccttg
cctgcctgtgagcgcgcacagtatttgcacaaactggcagaggcactacaggcgcgttcg
tcgcagatcggtgccgcactggctgatgagtctggcaagagcctgagtgatgccatggcc
gaagctggctatgccgctgaaatcacccgctaccatgccgaatgggccagacgtatcgaa
ggggaggtcatccccagcgacaacccgcaggaaaacctgctgctgatgcgcgaggccatc
ggcgtggtggtctgcctcattccgttcaacttccctgtctacaccttgctgcgcaagatc
gcgccagcactgatcaccggcaataccgtggtggtgcggcccagcaacaacacgccgtgc
tcggcctttgaaatcgcccacgctgtgctggatgccggcctgcctgccggcgtggtcaat
atcctgaccatgagccatgcggtggcagaaaccgtttgcacccatcccaaggtagggatg
atcaccctgaccggcagtgtcggggccggccgcaaggtgctggagtattcccaggtgaat
attgccaggtcatcgctcgagttgggcggcaagaccccggccatcatcgagccggatgcc
aagctggtgcaggcagccaatgacattgtggcatccgccctcagccactgtggccagctg
tgtacctcggtggaacgggtgtatgtgcaggacagcgtgtacgaggattttgtgcgcttg
ctcaaggagcgcttttcagtacgccagtatggcaaccgggcgcggcatcccaactacatg
ggtccgctggtcaatgcaacaacccggctcaatatccagcagatggtagagcgggcggtc
gatgatggtgcggtgctggaaaccggcggtttcattccgcaaggccctggctttttttac
ccacccaccttgcttacccagtgccgtcaggagatggaaatcgtacaggaagaaattttc
ggccctgtactgtgcgtcctcaaatacagcacggcagaagaagccttgctgctggccaac
gaccaccagtttggtctggcttcggtgctgtataccgaaaactaccgaaccgccatgcgt
tttgccaaccacatcgaagcgggcgagctgtatgtcaaccgcaccccggcagacccctac
cagggttatcacgccggctggaaacgctcaggcctgggtggcgacgatggcaagcacggc
atgctggagttcacccagacgcggctggtcgtcctgaaatactga

DBGET integrated database retrieval system