KEGG   Aquitalea magnusonii: DLM_1431Help
Entry
DLM_1431          CDS       T05698                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
amah  Aquitalea magnusonii
Pathway
amah00564  Glycerophospholipid metabolism
amah01100  Metabolic pathways
amah01110  Biosynthesis of secondary metabolites
Module
amah_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:amah00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DLM_1431
Enzymes [BR:amah01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     DLM_1431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase COX14
Motif
Other DBs
NCBI-ProteinID: BBF85055
UniProt: A0A3G9GC75
Position
1487951..1488832
Genome map
AA seq 293 aa AA seqDB search
MCGCPHSRFYIVSERFAVWLQYLLPKQALTILAGKLASAEAGSLTTAVIRWFVGRYQVNM
AEAANPDISSYPSFNQFFTRPLRADARPLADSALICPVDGAISQFGAIRADQIFQAKGHD
YSTTALVGGDADMAARYQDGQFATIYLSPRDYHRIHMPCDGRLLSMTYVPGALFSVNPAT
ARGVPGLFARNERVVCEFEGPHGRFVLTLVGATIVGSMGTVWHGIVNPPRPGRIQRWDYQ
DQQIMLRKGEEMGRFQLGSTVVLLFPAAAGLQFNAAWQPAGPVRLGECMADLV
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggctgtccgcattcaaggttttacatcgtgtccgaacgctttgccgtatggctg
caatatcttctgcccaagcaggctttaaccattctggccggcaagctggcaagtgccgaa
gccggcagcctgaccacggcggtcatccgctggtttgtcggacgctatcaggtgaacatg
gccgaagcggccaatccggatatcagcagctaccccagcttcaaccagttttttacccgc
ccgctgcgtgccgatgccaggcccttggccgacagcgcgctgatctgcccggtagatggt
gccatcagtcagtttggggcgatccgtgccgatcagatcttccaggccaaggggcatgat
tattccactaccgcactggtgggcggcgatgccgacatggcggcacgctatcaggacggc
cagttcgccaccatttatctgagcccgcgtgattaccaccgcatccacatgccttgcgat
gggcgtctgctcagcatgacttatgtgcccggtgcgctgttttcggtgaacccggctacg
gcgcgtggtgtacccggtctgtttgcccgtaacgagcgggtggtgtgtgagttcgaaggc
ccgcatggccgttttgtgctgacgctggtgggggccaccattgtaggcagcatgggcacg
gtctggcatggcattgtcaatccgccgcgtccgggccggattcaacgctgggattatcag
gaccagcagatcatgctgcgcaagggcgaggaaatgggccgcttccaactgggttctacc
gtggtgctgttgttccccgcggcagcgggtttgcagtttaatgcggcttggcagccggct
ggcccggtcagactgggcgaatgcatggccgatctggtctga

DBGET integrated database retrieval system