KEGG   Aquitalea magnusonii: DLM_3032Help
Entry
DLM_3032          CDS       T05698                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
amah  Aquitalea magnusonii
Pathway
amah00620  Pyruvate metabolism
amah00630  Glyoxylate and dicarboxylate metabolism
amah01100  Metabolic pathways
amah01110  Biosynthesis of secondary metabolites
amah01120  Microbial metabolism in diverse environments
amah01200  Carbon metabolism
Module
amah_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:amah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DLM_3032
   00630 Glyoxylate and dicarboxylate metabolism
    DLM_3032
Enzymes [BR:amah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     DLM_3032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: BBF86632
UniProt: A0A3G9GKR9
Position
3204403..3205998
Genome map
AA seq 531 aa AA seqDB search
MAVTLPQGVEILAPLTPAFEEILTTEALAFVAKLHRQFEGRRRELIAARVVRQAELDAGK
LPDFLPETAAIRAGDWKIAPLPQDLLDRRVEITGPVDRKMMINALNSGAKSFMADFEDSN
CPSWENQISGQINVRDAYRKTISFANPDGKQYKLNDTIATLILRPRGWHLMEKHVTVDGE
IVSGALFDFALSFFHNIAYLQTVGSATYYYLPKMEGHLEARLWNDVFVFAQKELGIPQGT
IKATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSCIKKFKQNRDFCLANRAQIT
MTVPFMRAYALLLLKTCHQRNAPAIGGMAALIPIKNDPVANEKALGGVKADKDRDATDGY
DGGWVAHPGLVPIANEAFSRVLGDAPNQIAKQRPDVNVTAADLLNFQPEAPITEAGLAMN
INVGIQYLGSWISGNGCVPIHNLMEDAATAEISRSQIWQWIRSPKGVLEDGRKVTVELFR
ELQAAEVAKLKAEYGNRWTKQYEDAASMFDHLTTSDDFVEFLTLPGYDYID
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcacccttccgcaaggcgtggaaatcctcgccccgctgaccccggcgtttgaa
gaaatcctcaccaccgaagccctggcctttgttgccaagctgcaccgccagtttgaaggc
cgccgccgtgagctgattgccgcccgcgtggtacgccaggcggaactggatgccggcaaa
ctgcctgacttcctgccggaaaccgccgccatccgcgctggcgactggaaaattgccccg
ctgccgcaagacctgctggaccgccgcgtggaaatcaccggcccggttgatcgcaaaatg
atgatcaatgcactgaactccggtgccaagagcttcatggccgacttcgaggactccaac
tgtccgagctgggaaaaccagatcagcggccagatcaacgtccgcgatgcgtatcgcaag
accatttcctttgccaacccggacggcaagcaatacaagctgaacgacaccattgccacc
ctgatcctgcgtccgcgcggctggcacctgatggaaaagcacgtcaccgtggatggcgag
attgtctccggcgcactgttcgacttcgccttgtccttcttccacaatattgcctacctg
caaaccgtgggcagcgccacctattactatctgcccaagatggaaggccatctggaagcg
cgcctgtggaacgatgtgttcgtgtttgcccagaaggaactgggtatcccgcaaggcacc
atcaaggccaccgtgctgattgaaaccatcctcgctgccttcgagatggacgaaatcctc
tacgaactgcgcgaacacagctccggtctgaatgccggtcgctgggactacatcttcagc
tgcatcaagaagttcaagcagaatcgcgacttctgcctggccaaccgtgcacagatcacc
atgaccgtgcccttcatgcgtgcctatgccctgctgctgctcaaaacctgccaccagcgc
aatgcgccggccattggcggcatggcggcactgattccgatcaagaacgatccggtggcc
aatgaaaaggcgctgggcggggtgaaggccgacaaggaccgcgatgccaccgacggctac
gacggcggctgggttgcccatccgggcctggtgccgattgccaacgaggccttcagccgc
gtgctgggtgatgcgcccaaccagattgccaagcagcgtccggatgtgaatgtcaccgcc
gccgacctgctgaatttccagccggaagcgccgatcaccgaagccggcctggccatgaac
atcaatgtgggcatccagtatctgggctcatggatttccggcaacggctgcgtgcccatc
cacaacctgatggaagatgccgccaccgcagaaatctcccgctcgcagatctggcaatgg
atccgcagccccaagggcgtgctggaagatggccgcaaggtgacggtggaactgttccgc
gaactgcaagccgccgaagtggccaagctcaaggcggaatacggcaatcgctggaccaag
cagtacgaggacgcagccagcatgttcgaccatctgaccacctcggatgactttgtcgag
ttcctcaccctgccgggttacgactacatcgactaa

DBGET integrated database retrieval system