KEGG   Alteromonas mediterranea UM7: I635_00930Help
Entry
I635_00930        CDS       T02724                                 

Definition
(GenBank) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
amai  Alteromonas mediterranea UM7
Pathway
amai00740  Riboflavin metabolism
amai00790  Folate biosynthesis
amai01100  Metabolic pathways
amai01110  Biosynthesis of secondary metabolites
amai02024  Quorum sensing
Module
amai_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:amai00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    I635_00930
   00790 Folate biosynthesis
    I635_00930
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    I635_00930
Enzymes [BR:amai01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     I635_00930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2 TMEM132D_N
Motif
Other DBs
NCBI-ProteinID: AGP95733
UniProt: S5C3V6
Position
complement(207286..207900)
Genome map
AA seq 204 aa AA seqDB search
MSSKQPKYEYVSTAKLPTRMGDFKIHGFVEASGQEHVALSYGEWKEDDVVPIRIHSECLT
GDSLFSTRCDCGFQLEKAMQNIVDNGHGVLLYLRQEGRGIGLLNKIRAYNLQDSGMDTVE
ANEHLGFDADLRSYDICKLMLDTLNVKHVELMTNNPKKLAALKALGIDVVARKPIDHGIT
KDNKNYLKTKTEKLGHAFDPHVFK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaaacagcctaaatacgaatatgtcagtaccgcaaaattacccacacgtatg
ggtgattttaaaatacacggttttgtagaagccagcggccaagagcacgttgccctttcc
tatggagagtggaaagaagatgacgtggtaccaattcgtattcattcagagtgcttaacc
ggtgactctttgtttagtacccgttgcgactgtggcttccagctagaaaaagccatgcaa
aatatcgttgataacggtcatggtgtactgctttacttgcgacaagaagggcgcggaata
ggccttttaaataaaattcgtgcttataaccttcaagatagcggcatggatacggttgaa
gctaacgaacatctcggctttgacgccgatttaagaagctatgatatttgtaagcttatg
ctggatacgctaaacgtaaaacacgttgagctgatgacgaacaaccctaaaaagttggcg
gcgcttaaagcattaggtattgacgtggtggcgagaaagcctattgatcacggcattacc
aaagacaataaaaattatttaaaaacaaagacggaaaagctaggtcacgcctttgacccc
cacgttttcaaataa

DBGET integrated database retrieval system