KEGG   Alteromonas mediterranea UM7: I635_01030Help
Entry
I635_01030        CDS       T02724                                 

Definition
(GenBank) aromatic acid decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
amai  Alteromonas mediterranea UM7
Pathway
amai00130  Ubiquinone and other terpenoid-quinone biosynthesis
amai00627  Aminobenzoate degradation
amai01100  Metabolic pathways
amai01110  Biosynthesis of secondary metabolites
amai01120  Microbial metabolism in diverse environments
amai01220  Degradation of aromatic compounds
Module
amai_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:amai00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    I635_01030
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    I635_01030
Enzymes [BR:amai01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     I635_01030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AGP95753
UniProt: S5C3X6
Position
complement(229707..230339)
Genome map
AA seq 210 aa AA seqDB search
MKHDKQVTLAITGASGAPYALTLLKSLVNADYQVFVLISSAAKVVFATEEDVKIPARPED
AAAFFSKHCDAKPDQIKVFGKEEWFSPVASGSAAPSKMVVCPCSTGTLSAISIGASDNLI
ERAADVVLKERGQLILVPREMPLSSIHLENMLKLSQMGATIMPAAPGFYHNPKTIEDLVD
FVVARILDHLGIEQSLVARWGYQSSKHSEV
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacgacaagcaagttacgcttgctattacgggcgcgtctggcgcgccgtacgca
cttacgctattgaagtcactggttaatgctgactatcaagtatttgttcttatctcttca
gccgcgaaggttgtttttgctaccgaagaggacgtaaaaattccagcgcgtcctgaagat
gctgccgctttttttagcaaacactgcgatgctaagcccgatcaaatcaaagtatttggt
aaagaggaatggttttctcctgtggcttcaggttcagccgcaccgtcgaaaatggtggta
tgcccctgctcaaccggcaccttatcggccattagtattggcgcaagcgacaacttgatt
gagcgagcggctgatgtagtgcttaaagagcgagggcaacttatattggtgccacgtgag
atgccgctttcttctatccatttagaaaatatgctcaagctttcgcaaatgggtgctact
attatgcccgccgcgccaggcttctatcacaatccgaaaactatcgaagacttagtggac
tttgtcgtggcgcgtatacttgaccatcttggcatagaacaatctcttgtcgccaggtgg
ggctaccaatcgtctaaacattcagaggtataa

DBGET integrated database retrieval system