KEGG   Alteromonas mediterranea UM7: I635_03645Help
Entry
I635_03645        CDS       T02724                                 

Gene name
apaG
Definition
(GenBank) CO2+/MG2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
amai  Alteromonas mediterranea UM7
Brite
KEGG Orthology (KO) [BR:amai00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    I635_03645 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 Phage_TTP_13
Motif
Other DBs
NCBI-ProteinID: AGP96270
UniProt: S5BUZ6
Position
complement(812212..812586)
Genome map
AA seq 124 aa AA seqDB search
MDVLDIKVRVKTRHLPDHLPSDSKQFAFAYHITIENKSNHTVQLINRYWKITDANGKTSE
IEGAGVVGKQPFLKAGEQFEYTSGAVIDTPVGNMEGYYEMELESKERFRVPINVFRLAIP
SILH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggatgtacttgatataaaggtgcgggtgaaaacccgccaccttccagaccaccttcct
tcagattcaaagcagtttgcttttgcctatcacatcactattgaaaacaagagcaatcat
accgttcagctgatcaaccgctattggaagatcaccgatgccaacggtaaaacctctgaa
atagaaggtgcgggggtagtaggtaaacaacctttcttaaaagccggtgaacagtttgaa
tataccagtggtgcggttattgacacacctgtggggaatatggaaggctattatgagatg
gagctagagagcaaagaacgctttcgagttcctatcaatgtatttcgattagccattcca
agcattcttcattaa

DBGET integrated database retrieval system