KEGG   Alteromonas mediterranea UM7: I635_04045Help
Entry
I635_04045        CDS       T02724                                 

Definition
(GenBank) fructose-1,6-bisphosphate aldolase
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
amai  Alteromonas mediterranea UM7
Pathway
amai00010  Glycolysis / Gluconeogenesis
amai00030  Pentose phosphate pathway
amai00051  Fructose and mannose metabolism
amai00680  Methane metabolism
amai01100  Metabolic pathways
amai01110  Biosynthesis of secondary metabolites
amai01120  Microbial metabolism in diverse environments
amai01130  Biosynthesis of antibiotics
amai01200  Carbon metabolism
amai01230  Biosynthesis of amino acids
Module
amai_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
amai_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:amai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    I635_04045
   00030 Pentose phosphate pathway
    I635_04045
   00051 Fructose and mannose metabolism
    I635_04045
  09102 Energy metabolism
   00680 Methane metabolism
    I635_04045
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:amai04131]
    I635_04045
   03036 Chromosome and associated proteins [BR:amai03036]
    I635_04045
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amai04147]
    I635_04045
Enzymes [BR:amai01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     I635_04045
Membrane trafficking [BR:amai04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    I635_04045
Chromosome and associated proteins [BR:amai03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    I635_04045
Exosome [BR:amai04147]
 Exosomal proteins
  Proteins found in most exosomes
   I635_04045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycolytic DUF4784
Motif
Other DBs
NCBI-ProteinID: AGP96350
UniProt: S5BV77
Position
895226..896125
Genome map
AA seq 299 aa AA seqDB search
MASQAQQAMLDKLKTQTGFIAALDQSGGSTPKALRLYGIEESEYSSDEEMFNLVHEMRTR
IITSTPFSGERVLGAILFENTLDREIEGMSSAHFLWQKKRVIPFLKVDKGLADESNGVQV
MKPMPGLDALLAKAVAQDVFGTKMRSVVKLANHQGIKDVVAQQFEVGKQILGAGLVPIIE
PEVDIHSPQKAEAEALLKLEILTQLNLLNEGQEVMLKLTLPTEANFYKELVDHPRVLKVV
ALSGGYSRDDANAKLAENQGMIASFSRALTEGVSAQQSQEEFEATLDKAIEGIYQASKA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggcatcacaagctcagcaggcaatgctggataaactgaagacgcaaaccggttttatt
gcagcgttagatcaaagcggcggtagtacccctaaagcgttacgcttatatggcatcgaa
gagtctgaatacagctcagacgaagagatgtttaaccttgttcacgaaatgcgtacgcgc
attatcaccagcacaccttttagcggcgagcgcgttctaggcgcaatcttgtttgaaaac
acccttgatagagaaatagaaggcatgtcttctgcacactttttgtggcagaaaaagcgt
gttattccttttttgaaagtggataaagggttagctgatgagagcaatggtgttcaagtg
atgaagcctatgccagggcttgatgcactattagcaaaagccgtagcgcaagacgtgttt
ggcactaaaatgcgcagtgttgttaagcttgctaatcaccaaggcattaaagatgttgtt
gctcagcaatttgaagtaggtaagcaaattctaggggctggccttgttcctattatcgag
ccagaagtagatattcacagcccgcaaaaagcagaagcagaagcactacttaagctagaa
attttaacccagcttaaccttctaaatgaaggtcaggaagtgatgctcaagctaacgcta
ccaactgaagctaacttttataaagaacttgttgatcaccctcgcgtacttaaagtggtt
gcgctttctggcggctacagccgtgacgacgctaatgctaagcttgctgaaaaccaaggt
atgatcgcgagtttctctcgcgctttaaccgaaggtgtatctgcacagcaatctcaagaa
gagtttgaagcaacactagataaagcgattgaaggtatttaccaagcttctaaagcctag

DBGET integrated database retrieval system