KEGG   Alteromonas mediterranea UM7: I635_11430Help
Entry
I635_11430        CDS       T02724                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
amai  Alteromonas mediterranea UM7
Pathway
amai00480  Glutathione metabolism
amai00590  Arachidonic acid metabolism
amai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amai00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    I635_11430
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    I635_11430
Enzymes [BR:amai01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     I635_11430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AGP97806
UniProt: S5C305
Position
2541821..2542375
Genome map
AA seq 184 aa AA seqDB search
MKTKGYAAALLSLSLFTPLSYANECPSVLKFMKRKLNSQETVNLCDEYAGKTLLVVNTAS
YCGYTPQFEGLEALYRNYKDKDFAVLGFPSHDFNQEDSDEGKTAELCELTYGVKFPMFEP
ISVKGDDADPMYRMLKNATGKAPSWNFNKYLIDSSGKQITHYPSSTKPTDAAFIADIEAL
LKSE
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaagactaaaggttatgcggctgccctactttcacttagtttattcacacctttgagc
tacgcgaacgagtgccctagcgtacttaaatttatgaagcgtaaacttaattctcaagaa
accgtaaacttgtgtgacgagtacgcaggaaaaaccttgttggtcgttaacactgcgagt
tattgtggttacacgccccagtttgaaggtttagaagcactttaccgcaactacaaagac
aaagattttgccgtgttgggttttccttctcacgattttaatcaagaagatagcgatgaa
ggtaaaactgctgaattgtgtgaactaacctatggcgttaagttcccgatgtttgagccg
atttctgttaaaggtgacgatgccgaccctatgtaccgtatgcttaaaaacgcgacaggc
aaagccccatcttggaatttcaacaagtaccttattgatagttcagggaaacaaattacc
cactaccctagttcaactaagcccacagatgcagcgtttattgcagatatagaagccttg
cttaaaagcgaatag

DBGET integrated database retrieval system