KEGG   Alteromonas mediterranea UM7: I635_12525Help
Entry
I635_12525        CDS       T02724                                 

Gene name
cysS
Definition
(GenBank) cysteinyl-tRNA ligase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
amai  Alteromonas mediterranea UM7
Pathway
amai00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:amai00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    I635_12525 (cysS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:amai01007]
    I635_12525 (cysS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:amai03016]
    I635_12525 (cysS)
Enzymes [BR:amai01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     I635_12525 (cysS)
Amino acid related enzymes [BR:amai01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   I635_12525 (cysS)
Transfer RNA biogenesis [BR:amai03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    I635_12525 (cysS)
 Prokaryotic type
    I635_12525 (cysS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AGP98020
UniProt: S5C031
Position
complement(2801977..2803359)
Genome map
AA seq 460 aa AA seqDB search
MLHLYNTRTREKAKFVPLQEGKVGLYVCGITVYDLSHMGHARTYLSFDVLVRYLRHLGLD
VKYVRNITDIDDKIIARANENGESFEALTARTIAMMHEDFAAINLLEPDVEPTVSGHMDE
IIEIIKRLMDKGYAYQAKSGDVLFDVSKYEDYGKLSKQDLDQLKAGARVEVAAGKDDPLD
FVLWKTTKPGEPAWQSPWGEGRPGWHIECSAMNHKHLGAHFDIHGGGSDLTFPHHENEVA
QSCCAYDTPYVNVWMHAGMVQVNDEKMSKSLGNFFTLRDVLKEHDSETLRFFLMSAHYRS
QLSYSQDNITQAKAALERLYTALRGVVVNESTDLSYGGYLARFEAAMNDDLNVPEAFSVL
FDVARELNRQKDNAEEAGKLAAVLKGLGAILGMLQSDPDTYLKGGEGNDDEAAEIEALIK
QRNDARASKDWAAADAARDALNAKGVVLEDGPSGTTWRKA
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgctacatctttacaacacccgaacccgtgaaaaagcgaagtttgttccgcttcaagaa
gggaaagtgggtttgtatgtgtgtggtatcaccgtttatgacctaagtcacatgggtcac
gcccgtacctacctaagtttcgacgtgttagtacgctatttgcgccaccttggtttagac
gttaagtacgtgcgtaatatcacagacatagacgacaaaattattgctcgcgctaatgaa
aacggcgaaagcttcgaagcactcacggcacgtactatcgccatgatgcacgaagacttt
gcagcgattaacctactagagccagatgttgagccgacagtaagcggccacatggatgaa
attattgaaatcattaagcgcctgatggataaaggctacgcttatcaagctaaaagcggc
gatgtgctattcgacgtaagtaagtatgaagattacggcaagctaagcaaacaagactta
gatcagcttaaagccggtgcccgtgttgaagtggcggcaggtaaagatgacccgctagac
ttcgtgctgtggaagaccaccaagcctggagagcctgcatggcaatcgccatggggcgaa
ggccgcccgggctggcacattgaatgttctgcaatgaatcataagcatcttggtgcgcac
tttgatattcacggcggtggctcagatttaaccttcccgcaccatgaaaatgaagtggct
cagtcgtgctgcgcatatgatacgccttacgtaaacgtgtggatgcacgcgggtatggtt
caagttaacgacgaaaaaatgtctaaatcgttgggtaacttttttactttgcgcgatgtg
ctaaaagagcacgattcagaaaccttgcgtttctttttgatgtcggcgcattatcgtagc
cagttaagttactctcaagacaatatcacccaagcgaaagcggcgctggagcgtttatat
actgcgctgcgtggtgttgtagtaaatgagagcacagaccttagctacggtggctaccta
gcgcgtttcgaagcggctatgaacgatgatctaaacgtacctgaagccttttcggtattg
ttcgatgtggcacgtgagcttaaccgccaaaaagacaatgctgaagaagccggtaaactg
gctgctgttcttaaaggcctaggcgcaattttgggtatgcttcaaagcgacccagatact
taccttaaaggcggtgaaggcaatgacgatgaagcggctgaaattgaagcgttaattaaa
cagcgtaacgatgcccgtgcctccaaagattgggcagcggcagatgccgcacgcgatgcg
ttaaacgcaaaaggcgtagtgttagaagacggcccaagcggtactacgtggcgtaaagcg
taa

DBGET integrated database retrieval system