KEGG   Alteromonas mediterranea UM7: I635_18645Help
Entry
I635_18645        CDS       T02724                                 

Definition
(GenBank) alternative dihydrofolate reductase
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
amai  Alteromonas mediterranea UM7
Pathway
amai00670  One carbon pool by folate
amai00790  Folate biosynthesis
amai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amai00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    I635_18645
   00670 One carbon pool by folate
    I635_18645
Enzymes [BR:amai01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     I635_18645
    1.5.1.50  dihydromonapterin reductase
     I635_18645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR NAD_binding_10 Epimerase NmrA RmlD_sub_bind TrkA_N GDP_Man_Dehyd NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AGP99224
UniProt: S5C7D0
Position
4211125..4211832
Genome map
AA seq 235 aa AA seqDB search
MNSPVLITGASQRLGLAMADSLLEQGHHVVVTYRTPRSSITMLEDKGATVLQADFSTEAA
IDRAIDEIKAISKTYRGVIHNASDWAQEKDSSDKHSLIERMMMVHAIAPYRINLALEAAL
CSCEGQADIIHMTDYVQETGSEKHMAYAASKAALHNLTLSFAKKLAPQVKVNSIAPALLM
FNEGDDDAYKEKALKKSLLEIVPGAKEAVKAMNYLFDSDYITGQTLHLNGGRHLK
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
ttgaactcacccgtcttaatcacaggcgctagtcaacgtcttggcctagccatggccgac
agtttacttgaacaaggccatcacgttgtggtgacgtacagaactccccgctcaagtatt
acgatgcttgaggataaaggcgctacagttttacaggctgattttagcactgaggcggct
attgatcgagcaattgatgagattaaggcaatcagtaaaacctatcgaggcgttatacac
aacgcgtcagattgggcccaagaaaaagacagtagcgataaacacagtttaatagagcgt
atgatgatggttcatgctattgcgccctatcgaataaatctggctttagaagccgcatta
tgttcatgcgaaggccaagccgacattattcatatgaccgactatgtgcaagaaaccggc
agcgaaaagcatatggcctatgccgctagcaaagccgcactgcataaccttaccctttca
tttgcgaaaaaattagcaccgcaggtgaaagttaacagtatcgctcccgctctgctcatg
ttcaatgaaggcgatgacgacgcctacaaggaaaaagcgctgaaaaaatcactgcttgaa
atagtacccggcgcgaaagaggcggtgaaagccatgaactacttgttcgacagtgactat
ataacggggcagacgctacacctaaacggtggcaggcatttaaaataa

DBGET integrated database retrieval system