KEGG   Alteromonas mediterranea U4: I607_07610Help
Entry
I607_07610        CDS       T02720                                 

Definition
(GenBank) beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
amal  Alteromonas mediterranea U4
Pathway
amal00520  Amino sugar and nucleotide sugar metabolism
amal01100  Metabolic pathways
amal01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:amal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    I607_07610
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    I607_07610
Enzymes [BR:amal01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     I607_07610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AGP85320
Position
1691773..1692783
Genome map
AA seq 336 aa AA seqDB search
MLDCQAEELLPEEKEKLAHPVVGGVILFTRNYHDKRQLSALVQDIRRFAKNNVLIAVDHE
GGRVQRFRDGFTAIPAMGDILRQSEHQDESAAYAKACGLALAYELKALDIDFSFAPVLDI
NGVSKVIGDRAFSNNADEVIRLATQLIQGLKTVNMPAIGKHFPGHGSVAPDSHIALPVDE
RGFDEIRRTDMVVFERVIERALLDGVMPAHVIYNQVCDKPAGFSSTWLKTILKNDIGFNG
AVFSDDLSMHGASVAGSYVERAEAALEAGCDMVLACNNPKGAESILDGLEARFSNPNNSD
VARQERVMALYGRVMPAGLYDKYESAVALIARLSER
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgttggactgtcaggccgaagaactcttgcctgaagaaaaggaaaagttagcacaccca
gtggttgggggcgtaattttatttacccgaaactatcacgataagcgccagttatctgcc
ttggttcaagatatccggcgttttgctaaaaataacgtgctaattgccgtggatcacgaa
ggtggtcgcgttcagcgttttcgagacgggtttaccgcgataccggcaatgggcgatatt
ttacggcagtctgaacatcaagatgaaagcgcggcatatgcaaaagcgtgtggtttagcg
ttagcttacgaactaaaagccctagatatcgattttagcttcgcaccggttctcgatatt
aatggtgtgtcgaaagttattggcgatagggcgtttagtaataatgctgatgaggttatt
cgccttgctacacagcttattcaagggctaaaaaccgtgaacatgcctgctattgggaag
cactttcccgggcacggcagtgtagccccagattctcatattgctttacctgtggatgag
cgcggttttgacgagatacgccgtaccgacatggtggtgtttgaacgcgttattgaacgt
gccctactagatggcgttatgcccgcccacgttatttataatcaagtttgtgacaagccg
gctggtttttcttcaacgtggctaaaaaccattttgaaaaacgatataggttttaacggt
gccgtgttttctgatgatttgtcgatgcacggtgcaagcgttgcgggaagctatgttgag
cgcgctgaagcagcgcttgaagctgggtgcgatatggtactggcgtgcaacaacccgaaa
ggcgcggagagtattctagatggtttagaggcacgcttttcaaacccgaataacagtgac
gtagcaaggcaagagcgagtgatggcactgtatgggcgagtgatgcccgccgggctttac
gataagtatgaaagcgcagtggcccttattgcgcggttaagtgaacgatag

DBGET integrated database retrieval system