KEGG   Alteromonas mediterranea U4: I607_07760Help
Entry
I607_07760        CDS       T02720                                 

Definition
(GenBank) acetyl-CoA acetyltransferase with thiolase domain
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
amal  Alteromonas mediterranea U4
Pathway
amal00071  Fatty acid degradation
amal00072  Synthesis and degradation of ketone bodies
amal00280  Valine, leucine and isoleucine degradation
amal00310  Lysine degradation
amal00362  Benzoate degradation
amal00380  Tryptophan metabolism
amal00620  Pyruvate metabolism
amal00630  Glyoxylate and dicarboxylate metabolism
amal00640  Propanoate metabolism
amal00650  Butanoate metabolism
amal00900  Terpenoid backbone biosynthesis
amal01100  Metabolic pathways
amal01110  Biosynthesis of secondary metabolites
amal01120  Microbial metabolism in diverse environments
amal01130  Biosynthesis of antibiotics
amal01200  Carbon metabolism
amal01212  Fatty acid metabolism
amal02020  Two-component system
Brite
KEGG Orthology (KO) [BR:amal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    I607_07760
   00630 Glyoxylate and dicarboxylate metabolism
    I607_07760
   00640 Propanoate metabolism
    I607_07760
   00650 Butanoate metabolism
    I607_07760
  09103 Lipid metabolism
   00071 Fatty acid degradation
    I607_07760
   00072 Synthesis and degradation of ketone bodies
    I607_07760
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    I607_07760
   00310 Lysine degradation
    I607_07760
   00380 Tryptophan metabolism
    I607_07760
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    I607_07760
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    I607_07760
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    I607_07760
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amal04147]
    I607_07760
Enzymes [BR:amal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     I607_07760
Exosome [BR:amal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   I607_07760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGP85350
Position
1725856..1727031
Genome map
AA seq 391 aa AA seqDB search
MSNESVVIVAAKRTPMGGFNGSLSSLAATKLGEIAIKAACDEVDVSVIDEVIMGCVLPAG
LGQSPARQASIGAGLPLSAGVTTINKVCGSGLKAVMMAHDLIKAGSASAVVAGGMESMSN
APYMLPKARTGYRMGHGQVIDHMMLDGLENAYDGKAMGCFAQDTADEENIGRGEMDEFAL
SSLSKAHEAINSGTFNDEIAPVTVSSRKGDTVVDTDEGPGSARPEKIPTLRPAFKKDGTV
TAANSSSISDGAAALVVMSESKAKALGLAPLAKVVAHATNSIEPENFTVAPVGAMEKVLD
KAGWTKEDVDLFEINEAFAMVTMLAIKKLGLDESKVNVKGGACALGHPIGASGARILVTL
LHALKQSNGRKGIASLCIGGGEGVALAVEML
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatgaatcagtagtgatagtcgcggcgaaacgtacacctatgggtggttttaac
ggtagcttgtcttctctcgctgcgacaaagcttggagaaattgcgataaaagctgcgtgt
gatgaggtggatgtctctgtaattgacgaggtcattatggggtgtgttttaccggctggg
ttagggcagtctcctgcgcgacaagcgtcaataggggcggggcttccgctaagtgccggt
gttaccactatcaataaagtctgtggttcaggcttaaaagcagtcatgatggcccatgat
cttatcaaagcaggcagcgcctctgcggtggtagctggcggtatggaaagtatgagtaac
gcgccatacatgttgccaaaagcgcgaacgggttatcgcatggggcatggccaagttatt
gatcacatgatgctagacggccttgagaatgcttacgacggtaaagcaatggggtgcttt
gctcaagatactgctgatgaagagaatattggccgcggtgaaatggatgaatttgcatta
agttcattgtctaaagcgcatgaagcaataaatagcggcacgttcaacgacgaaattgca
ccagtaactgtatcttcacgtaaaggtgatacagtggtggatactgatgaaggcccgggc
tctgctcgacctgaaaagatccccacactccgcccagcctttaaaaaagacggtacggta
acggcagcgaactctagctctatctctgacggtgcagcagcacttgttgttatgagcgaa
agcaaagctaaagcccttggattggcgccattagcaaaagtggtagctcatgctacgaac
tcaatagagcccgagaattttacggttgcaccggtaggcgcaatggaaaaagtgttagac
aaagctggttggacaaaagaagacgtagatctctttgaaatcaacgaagcttttgccatg
gtaactatgctggcgattaaaaagctagggcttgatgaaagcaaagtgaacgtaaagggc
ggggcatgcgcattaggccatcccattggcgcttctggcgcacgcatccttgtaacactt
cttcatgcacttaaacaaagcaatggtcgtaaaggtatagcatcgttgtgtattggcggt
ggagaaggcgttgctcttgctgttgagatgctttaa

DBGET integrated database retrieval system