KEGG   Alteromonas mediterranea U4: I607_08100Help
Entry
I607_08100        CDS       T02720                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
amal  Alteromonas mediterranea U4
Pathway
amal00071  Fatty acid degradation
amal00072  Synthesis and degradation of ketone bodies
amal00280  Valine, leucine and isoleucine degradation
amal00310  Lysine degradation
amal00362  Benzoate degradation
amal00380  Tryptophan metabolism
amal00620  Pyruvate metabolism
amal00630  Glyoxylate and dicarboxylate metabolism
amal00640  Propanoate metabolism
amal00650  Butanoate metabolism
amal00900  Terpenoid backbone biosynthesis
amal01100  Metabolic pathways
amal01110  Biosynthesis of secondary metabolites
amal01120  Microbial metabolism in diverse environments
amal01130  Biosynthesis of antibiotics
amal01200  Carbon metabolism
amal01212  Fatty acid metabolism
amal02020  Two-component system
Brite
KEGG Orthology (KO) [BR:amal00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    I607_08100
   00630 Glyoxylate and dicarboxylate metabolism
    I607_08100
   00640 Propanoate metabolism
    I607_08100
   00650 Butanoate metabolism
    I607_08100
  Lipid metabolism
   00071 Fatty acid degradation
    I607_08100
   00072 Synthesis and degradation of ketone bodies
    I607_08100
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    I607_08100
   00310 Lysine degradation
    I607_08100
   00380 Tryptophan metabolism
    I607_08100
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    I607_08100
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    I607_08100
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    I607_08100
Enzymes [BR:amal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     I607_08100
Exosome [BR:amal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   I607_08100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ChlamPMP_M CHGN
Motif
Other DBs
NCBI-ProteinID: AGP85415
Position
1812289..1813470
Genome map
AA seq 393 aa AA seqDB search
MRDAVIVSTARTPIGRAYKGALNNLPAPSLGGHAIENAVSRAGIDPASVDDVIMGAALTQ
GSGGMNIGRLAGLAGGLPVTVAGMTLDRQCSSGMYAIATAANAIRTGDTNIMVAGGLDSI
SLVQNKNMNMFRAVDPALVAKHKDIYMPMLQTAEVVGKRYNISRDVQDEYGYQSQMRTAA
AQEAGKFDDEIVPITAVQAVFNKETGETSEREVTLSKDEGNRPETTLEGLKALNPVIEGG
CITAGNASQLSDGASATVIMDEQSAAKGSAQPIGIYRGIAVAGCEPDEMGIGPVFAIPKL
LKQHGLTMDDIGLWELNEAFAVQVLYCRDKLGIPDELLNVNGGAISIGHPYGMSGARMVG
HALIEGKRRGAKYVVCTMCIGGGMGAAGLFEVI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgatgcagtaattgtaagtacagcacgtacaccaataggccgtgcctataaaggc
gcactaaacaacttacccgcgccgtcgttaggtggtcatgccattgaaaatgcggtatct
cgtgcgggtattgaccctgctagcgtagatgacgtcatcatgggcgcagcgctcacacaa
ggcagcggtggtatgaacatcggccggttagccgggcttgccggcggccttcctgttacg
gttgcgggtatgacccttgaccgtcaatgtagttcaggtatgtacgccatcgctacagca
gcaaatgctattcgtactggcgataccaacattatggtagccggtggtttagattctatt
tcactggtacaaaacaagaacatgaatatgttccgtgccgttgaccctgcacttgttgct
aagcacaaagatatctacatgccgatgcttcaaaccgctgaagtggtaggcaagcgttat
aacattagccgcgatgtacaagatgagtacggctaccaaagtcaaatgcgcacagcagca
gcgcaagaggccggtaagtttgacgacgaaattgtacctattacagcagttcaagcggtg
ttcaataaagaaacgggtgaaacctctgagcgcgaagtcaccttgtctaaagatgaaggt
aatcgcccagaaactactcttgaaggtttgaaagcgttaaaccctgttattgaaggcggc
tgcattacagctggcaacgcgagccagctttcagacggcgcaagtgcaacagttattatg
gatgagcagtcagcagcgaaaggcagtgctcagccaattggtatttatcgcggtattgca
gtggcaggctgtgaacctgatgaaatgggaattggcccggtattcgccattcctaagcta
ttaaagcagcatggattaaccatggacgatatcggtctatgggaacttaacgaagcattt
gcagtacaggtactctactgccgcgacaagttaggtattccagacgaattattaaatgta
aacggcggtgccatttctattggtcacccatacggcatgagcggtgctcgcatggtgggt
cacgcactcatcgaaggtaaacgacgtggtgcgaaatatgtagtttgcaccatgtgtatc
ggtggcggcatgggcgctgctggtctatttgaagttatatag

DBGET integrated database retrieval system