KEGG   Alteromonas mediterranea U4: I607_11115Help
Entry
I607_11115        CDS       T02720                                 

Definition
(GenBank) coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
amal  Alteromonas mediterranea U4
Pathway
amal00860  Porphyrin and chlorophyll metabolism
amal01100  Metabolic pathways
amal01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amal00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    I607_11115
Enzymes [BR:amal01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     I607_11115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: AGP86010
Position
2473677..2475053
Genome map
AA seq 458 aa AA seqDB search
MNTIAIKQLRDNSTITKYAQHAPRYTSYPTALKFESLKEDLSPHALTVSKAKAVSLYVHI
PFCKTLCYYCGCNKLVTRHNEKADDYLDYLEKEIVSKRYLADDKPVVSLHLGGGSPSFLN
KVQHTFLMYLLKKHFTFEVGAELSIELDPRNVDKTYLQNLRGLGYTRISFGLQDTDYNVQ
KTINRVQSTSHIADLVSEARTLGFESVNLDLIYGLPNQSEETFASTIAATKAMMPDRISL
FSYAHLPERFAAQRKFAPGTLPSSEEKAALYNLAVNGFKRVGYEMIGLDHFALRSDSLAI
AKHKGKLHRNFQGYTLRGDTDLIGVGVSAISTIGNAFTQNAKDLKEYYKRIDRQLPSAKV
GLSLTPDDLVRRDVISSLMCNLSVDKQSISSKHHIIFDEYFSEALSNLERLADDGIIEIS
AHHIRVPEHARIFIRAVCARFDAYLNATETLSNYSKAI
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccattgctataaaacaacttcgcgataattccactataaccaaatatgcgcaa
catgcacctcgttatacctcgtaccctactgcacttaagttcgaatcgctaaaagaagat
ttatcccctcacgcgctaaccgtgtctaaagcgaaagccgtgagtttgtatgtgcacatt
cctttttgtaaaacgctttgctattactgcggctgcaacaaacttgtgactcggcacaac
gaaaaggcagacgactatttagactacttagaaaaagagatagtttctaagcgttattta
gcagacgataagcctgtagtttcgctgcatttaggcggtgggtcgcccagttttttaaat
aaagttcagcacacttttttaatgtaccttttgaaaaaacatttcacgtttgaagtaggc
gctgaattatctattgaattagacccaagaaacgttgataaaacctatttacaaaatctg
aggggcttgggctatacccgtatcagctttggccttcaagacactgactacaacgtgcaa
aaaacaataaaccgtgttcaaagtacttcgcatatcgcagatttagtgtccgaagcccgt
actttaggtttcgaatcggtgaatttggatttaatttacggcctgcctaaccaatcagaa
gagacttttgcatctaccatagctgcaactaaagccatgatgccagaccgtatctcgctc
tttagctacgctcatctgccagagcgctttgccgcacagcgaaagtttgcgccaggaact
cttcctagtagcgaagagaaagcagccttgtacaaccttgctgtaaatggctttaaaaga
gtggggtatgaaatgattgggctggatcattttgcgttacgcagcgattcactcgccatc
gctaagcacaaaggtaagcttcaccgaaacttccaaggctatactttgcgcggagatacc
gacctaattggcgtcggcgtgtctgctattagcacaataggtaatgcttttactcaaaac
gccaaagatttgaaagagtactataaacgtatagacagacaattaccctcagccaaagtt
gggctttcgttaacaccagacgacctcgttcgtcgtgatgtaatatcaagcttgatgtgc
aacctgtctgtagataaacagagtatttccagcaagcatcatattatttttgacgagtac
ttttcagaagcattaagtaatttagagcgtcttgcagacgatggaatcattgaaatttcg
gcgcaccacatacgggtaccagaacatgctcggatatttattagagcggtatgtgcccgt
tttgatgcctacctaaatgcgactgaaacgcttagtaattactctaaggcaatttaa

DBGET integrated database retrieval system