KEGG   Alteromonas mediterranea U4: I607_18450Help
Entry
I607_18450        CDS       T02720                                 

Gene name
ompR
Definition
(GenBank) osmolarity response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
amal  Alteromonas mediterranea U4
Pathway
amal02020  Two-component system
Brite
KEGG Orthology (KO) [BR:amal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    I607_18450 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:amal02022]
    I607_18450 (ompR)
Two-component system [BR:amal02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   I607_18450 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: AGP87458
Position
4157812..4158534
Genome map
AA seq 240 aa AA seqDB search
MGQETSKILVVDDDMRLRSLLERYLLEQGYQVRSAANAEQMDRLLERENFHLMVLDLMLP
GEDGLSICRRLRQQENDMPIIMLTAKGDEVDRIIGLEMGADDYLPKPFNPRELLARAKAV
LRRRSSEAPGAPSKDVQIVEFGDYKLNLATREMTAGDKPLTLTSGEFAVLKSLVTHPREP
LSRDKLMNLARGRDYSALERSIDVQVSRLRRMLEEDPANPRYIQTVWGLGYVFVPDGEQV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaggaaacctcaaaaattctcgttgttgatgatgatatgcgcttacgtagcctg
ttagagcgttatctgctagagcaaggttatcaagtgcgcagcgcggcaaacgctgagcaa
atggacagattgctagaacgtgagaattttcatcttatggttttagaccttatgctgccc
ggtgaagatggcctgtctatttgtcggcgcttgcgccagcaagaaaacgacatgcctatt
attatgcttaccgccaagggcgatgaagtagaccgcattatcggccttgaaatgggcgca
gacgattacttacctaagccctttaaccctcgtgaactgctggcgcgcgctaaagcggtg
ttgcgcagacgcagcagcgaagcgcccggcgcgccttcaaaagatgttcaaatagtcgaa
ttcggtgactataagcttaatttagccacccgcgaaatgaccgctggcgataaaccgcta
accctgactagcggcgagtttgccgtattaaaatcgctggtgactcacccccgcgagccg
ctttcgcgagataagctaatgaacctagctagaggccgtgactacagtgcattagagcga
agcatcgacgttcaggtttctcgtttgcgtagaatgctagaagaagaccctgctaaccca
cgctacatacaaaccgtatggggcttaggctatgtcttcgttccagacggtgagcaagta
tag

DBGET integrated database retrieval system