KEGG   Acidianus manzaensis: B6F84_00530Help
Entry
B6F84_00530       CDS       T04836                                 

Definition
(GenBank) phenylacetate--CoA ligase
  KO
K01912  phenylacetate-CoA ligase [EC:6.2.1.30]
Organism
aman  Acidianus manzaensis
Pathway
aman00360  Phenylalanine metabolism
aman01100  Metabolic pathways
aman01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aman00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    B6F84_00530
Enzymes [BR:aman01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.30  phenylacetate---CoA ligase
     B6F84_00530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C_2 GH3
Motif
Other DBs
NCBI-ProteinID: ARM74657
UniProt: A0A1W6JWN3
Position
complement(165438..166724)
Genome map
AA seq 428 aa AA seqDB search
MIYDETDPYALSKDEIQSIQQFRFRRMIKRICENSPYYHKIFKEKGLTADDIKTPDDLVK
LPFTTKENIRNNGYPYGGDFLTVPLSEIVGWHMTSGTTGTPTVTAYTKSDIELWAKLVAR
CLNTAGVRKDDVIANVYGYGLFTGGIGLHIGGQELGAKVIPWSSGRADALVKTLKDFKVT
VLTGTPSFELYIAQKIREQGVDPEKDLNLRLAIPGAEAMTPEMIERIERELSLPSHGGGA
REIYGLTEAIGPGVAQECPLDRHKEMHIWTDHFYVEIIDPETGERVGEGEEGELVLTHLD
REGMPLIRYRTRDITKLIESDDEVPFPKISIIKGRIDDVIFYKGVKIYPTAINAVMLKHP
EVKEYKVIITRDPAKFEILVEAEKSSEELARKISEEIEGVTFAKPKIEFVQPNTLPRWEG
KSKRVEIK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgatttatgacgaaacagatccttatgcattatcaaaagacgaaatacaaagtatacaa
caatttaggttcagaaggatgataaaaaggatttgtgagaacagtccttattatcataaa
atattcaaagaaaaaggattaacagctgacgatataaaaactccagatgacttagtaaaa
ttaccattcacaacaaaagaaaacataagaaataacggatatccttatggtggagatttt
cttacagtacctttaagcgaaatagtaggctggcatatgactagtggaacaactggaact
cctacagtaacagcttacacaaaatcagatatcgaattatgggcaaaattagtagctaga
tgcttaaatacggctggtgtaagaaaagacgacgttatagccaacgtttatggatatgga
ttatttaccggaggaataggattacatataggaggacaagagttaggagcaaaagttatt
ccttggagctcagggagggcagatgcattagttaaaacattaaaggatttcaaagttact
gtattaactggaactccatcgtttgagctgtatatagcacaaaagataagagaacaaggg
gtagatccagaaaaagatctaaatttaaggctagcaatacctggagcagaagctatgacg
ccagaaatgatagaaagaatagaaagagaattatctttgccttctcatggtggaggagcc
agagaaatttacggattaacagaagcaataggtcctggagtagcacaagaatgtccatta
gacagacataaagaaatgcatatatggacagatcatttctacgtagaaataatcgatcca
gaaactggggaaagagtaggagaaggagaggaaggagaactagttcttactcatttagat
agagaaggaatgccattaataaggtacagaaccagagatataactaaactaattgaatca
gatgacgaagtcccattccctaagatctctataattaaaggaagaatagatgacgtaata
ttctataaaggagttaaaatatatcctactgcaataaatgcagtaatgctaaaacatcct
gaagttaaggaatataaagtaatcataaccagagatcctgctaagtttgaaattcttgtt
gaagcagaaaaatcatcagaagaattagcaagaaagatatcagaagaaatagaaggagta
acgtttgcaaaacctaaaatagaatttgtacaacctaatacattacctagatgggaagga
aaatcaaaaagagtagaaataaaatag

DBGET integrated database retrieval system