KEGG   Acidianus manzaensis: B6F84_04395Help
Entry
B6F84_04395       CDS       T04836                                 

Definition
(GenBank) aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
aman  Acidianus manzaensis
Pathway
aman00051  Fructose and mannose metabolism
aman01100  Metabolic pathways
aman01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aman00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    B6F84_04395
Enzymes [BR:aman01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     B6F84_04395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ARM77062
UniProt: A0A1W6K3N6
Position
912340..913056
Genome map
AA seq 238 aa AA seqDB search
MVYMIGNTYCKLCQSDENQLKKELVNSVKTLYWKGMISNAGGNQSARLPGSEKIWITPSG
YPRVSLEPEDLIAVDLEGNVIEGDLKPSIETKMHLEVYKVRPDVNAVIHAHSPYTMGLAI
SGFFDITHGEAAAILGEIKIVKYSHPGTIELAKNVGEALKGEGAKVPRIAILMNHGIISV
GACIHEARAFAEIMEEWARFNVAAKAIGNIKYKLNKDELKKPGARYIRAVKFGGRQIT
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggtttatatgataggaaatacgtactgtaagctttgtcaatcagatgaaaatcagctt
aaaaaagagctagttaatagtgtaaaaacactttattggaaaggaatgataagtaatgct
ggaggcaatcagagtgctagattacctggatctgaaaaaatatggataactccttctgga
tatccaagagttagcctagaacctgaagacttaattgcggtagatctggaaggtaacgtt
attgaaggagatttaaagccttcaatagaaactaaaatgcatctggaagtttataaggtt
agaccagatgttaatgcagttatccatgctcattcaccatatacaatgggattagccata
tctggattttttgacataactcatggagaagcagcagcaatactaggagaaataaagata
gtaaaatattcacatccaggaacaatagaattagctaaaaatgtaggcgaagcattaaaa
ggtgaaggagctaaggttcctagaatagcaattttgatgaatcacggcataatatctgtt
ggtgcatgtattcatgaagctagagcattcgctgagataatggaagaatgggcaagattt
aacgtagcagctaaagctataggaaatataaaatataaactaaataaagatgaattgaaa
aaacctggagccagatatataagggcggtaaaatttggaggaaggcagattacttga

DBGET integrated database retrieval system