KEGG   Acidianus manzaensis: B6F84_12265Help
Entry
B6F84_12265       CDS       T04836                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
aman  Acidianus manzaensis
Pathway
aman00620  Pyruvate metabolism
aman00630  Glyoxylate and dicarboxylate metabolism
aman01100  Metabolic pathways
aman01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aman00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B6F84_12265
   00630 Glyoxylate and dicarboxylate metabolism
    B6F84_12265
Enzymes [BR:aman01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     B6F84_12265
    1.2.1.22  lactaldehyde dehydrogenase
     B6F84_12265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC LtuA
Motif
Other DBs
NCBI-ProteinID: ARM76709
UniProt: A0A1W6K2G9
Position
2355099..2356583
Genome map
AA seq 494 aa AA seqDB search
MEKIQELFINGEWVKPSSEEYLTKYNPSTGEIYGKFAAASRDDADRIIDAAYDAQKKWEK
LTSVERSKYLYKLIDLIRQDRESLEELLMDEVGKPKREAVQEVDGVLDQLQFYAEFARKI
NGDVVEGTKSERIIYQYKVPYGVVLAITPWNFPAAMVARKIGPALITGNTVVVKPSSDTP
FTAGWIVEKARQAGFPPGTINLITGKGSVVGDYLTSHKKVSVITLTGESKTGQQVMKSSS
SIMAKLILELGGKAPFIVWKDADLELAAKVLMWAKYWNAGQSCIAAERLYIHEDVYDKFL
NLFLEKTKTLKIGDPRNSDMGPLINNQAVNKVSGFVENAISQGAKVIYGGGKPELSDRLS
KGFFYMPTIITDVKQNMEIFREEIFGPVIGAMKVSDDFNEVIELANDSDYGLASYLFTKD
LSLAMKASREIKFGELYINMPGPEASQGYHTGFRLSGQAGENSKYGIEEYVKVKNIYIDY
SKDPTKDEVIPPYT
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggagaagattcaagaattattcataaacggagaatgggtaaagccttcttctgaagag
tatctaacaaaatataatcctagtactggagaaatttacggtaagttcgctgctgcatct
agagatgacgcagatagaattatagatgcagcatacgatgctcagaagaaatgggaaaaa
ttaacgtcagttgaaagaagtaaatacttatataaattaatagatttgattagacaagat
agagaatcgttagaagaactattaatggatgaggtaggtaagccaaaaagagaagcagtt
caagaagtcgatggagttttagatcagttgcagttttatgctgaatttgcaagaaaaata
aatggagatgttgttgaaggaactaagagtgaaagaataatttatcagtataaggttccc
tatggcgtagtcttagctataactccatggaattttccagcagcaatggttgctagaaaa
ataggtcctgctttaataactggaaatacagtagtagtaaagcccagttcagatactcca
tttactgcaggatggatagtagaaaaagctaggcaagctggatttccaccaggaacaata
aatttaatcacaggtaaaggaagtgttgtaggagattatttaacatcacataaaaaagtt
tcagtaataacattaactggagaatcaaaaactggacaacaagtaatgaaatcatcatct
tcaattatggctaaactaatcttagaattaggtggaaaagctccttttatagtatggaaa
gatgcagacctagaactagcagctaaagttttaatgtgggcaaagtattggaatgcagga
caatcctgcatagctgcagaaagattatatatacatgaagatgtttacgacaaattcttg
aacttattcttagaaaaaactaaaacattgaaaataggagatccaagaaattctgatatg
ggtccattaataaataatcaagcagtaaacaaagtatctggattcgttgagaacgcaatt
tctcaaggagcaaaagtaatatatggtggaggaaaacctgaattgtcagataggctttct
aaaggattcttctatatgcctacaataattaccgatgtgaaacaaaatatggaaatattt
agagaagaaatatttggtccagtaattggcgcaatgaaagtttcggatgatttcaacgaa
gtaatagaattagctaatgattcagattatggattagcatcatatttatttacaaaagat
ttatcattagcgatgaaggcttctagagaaattaagtttggtgaattatacattaatatg
cctggtccagaagcttcgcaagggtatcatactgggtttagattatctggtcaagcagga
gaaaactctaagtacggtatagaagaatatgttaaagttaagaacatatacatagattat
agtaaagatccaacaaaagatgaggtaataccaccatatacataa

DBGET integrated database retrieval system