KEGG   Alteromonas mediterranea U8: I634_05595Help
Entry
I634_05595        CDS       T02722                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
amao  Alteromonas mediterranea U8
Pathway
amao00620  Pyruvate metabolism
amao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    I634_05595
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:amao02000]
    I634_05595
Enzymes [BR:amao01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     I634_05595
Transporters [BR:amao02000]
 Other transporters
  Primary active transporters [TC:3]
   I634_05595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_D23 GCV_H PTS_EIIA_1 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AGP92845
Position
1275620..1277434
Genome map
AA seq 604 aa AA seqDB search
MSKPLALTELVLRDAHQSLLATRMRIEDMLPIAEKLDKAGFWSVESWGGATFDACIRYLG
EDPWERIRKLKAAMPNTKQQMLLRGQNLLGYRHYADDVVTRFVERAHESGVDVFRIFDAM
NDIRNLKTAIKATIDSGAHAQGTISYTVSPVHNLKLWLDMAKQLEDLGVHSICIKDMAGL
LKPYECEALITGLKETVSVPIAMQCHATTGLSTATYQKAVDAGIDMLDTAISSMSMTYGH
TATETMVSIVEGTERDTGIALPELEEIASYFRDVRKKYSKFEGSLKGVDARILLAQVPGG
MLTNMESQLKEQGAEDKFEEVLKEIPRVREDLGFIPLVTPTSQIVGTQSVLNVLTGERYK
SITKETAGVLKGEYGATAAPVNKALQERVLDGAEPVTCRPADNIAPELDALSKELDELAE
KKQLSLSDDKIDDVLTYALFPQIGLKFIENRGNPDAFEPAPSAQSSQSADVAQVEKSAAN
TSSSGSETYDVNVDGKVYHVEVAPSGTLKSVTPAGAAQSSAPAPASNTQASAGTSQSIDA
PLAGNVFKILVKNGDSIAEGDVVMILEAMKMETEIRTAFTGTVTEVTVGEGDAVSSGQPL
ILLG
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagcctctggcccttaccgagctggtcctgcgtgatgcccatcagtcactacta
gctacgcgaatgcgtattgaagatatgcttcccatcgcggaaaaattagataaagctggc
ttttggtcagtagagtcgtggggcggcgctacctttgacgcttgcattcgatacttggga
gaagacccatgggaacgtatcagaaagctaaaagccgccatgcctaataccaagcagcaa
atgttgctacgaggccaaaacttgctggggtatcgacattacgctgacgatgttgtgacc
cgctttgtagagcgcgcccatgaaagcggcgttgatgtatttagaatttttgatgcaatg
aacgacatcagaaatttaaaaacggcaattaaagcaaccatagacagcggtgcgcacgcg
caaggcaccatttcatataccgtaagcccagtgcacaatctaaagctttggcttgatatg
gccaaacagcttgaggacttaggcgttcattccatttgtattaaagatatggcagggctt
ttaaagccttacgaatgcgaagcgctcataacagggctgaaggaaacggtaagtgtacct
attgccatgcagtgtcatgctacgacagggttaagtactgccacctatcaaaaagccgta
gacgcgggcattgatatgctcgacaccgctatctcgtcaatgagtatgacatatggccat
accgccacggaaacgatggtatcgattgtagagggtacagagcgtgacaccggcatcgca
ttgccagaactggaagaaattgccagctacttcagagatgtaagaaaaaaatacagcaag
tttgaaggaagcttaaagggcgttgacgcacggattttgctagcgcaagtgccaggcggc
atgctaaccaacatggaaagccagcttaaagaacagggcgctgaagataaattcgaagaa
gtactaaaagaaattccacgggtacgggaagatctcgggtttattcctcttgttacgcca
acctctcaaattgtaggcacgcaatcggtacttaacgtactaacaggcgagcgctacaag
agcatcacgaaagaaaccgctggcgtacttaaaggcgaatacggcgccaccgcggcacca
gtaaataaagcgctgcaagagcgtgtgcttgatggtgctgagcctgtgacgtgccgaccg
gctgataacattgcccccgaacttgatgcactaagtaaagagcttgatgaactcgcagag
aaaaagcagctttcgctttcagatgacaaaattgatgatgtgcttacttacgccttgttt
ccgcagataggccttaagtttatcgaaaatcgcggtaatcctgatgcgtttgaacctgca
cctagtgcacagtcatcgcaatcagcagatgtagctcaagtagaaaaatctgcagcaaat
acgtcttcatctggcagcgaaacttacgatgtaaacgttgatggtaaggtatatcacgta
gaagtcgcaccatccggtaccttaaaaagcgtaacaccagcaggtgctgctcaatcatcg
gcgccagcgccagcgagcaatactcaggcatctgcaggcacttcccagtctattgatgca
ccgttagcgggtaacgtatttaagatacttgttaaaaacggtgacagtattgccgaaggt
gatgtagttatgatccttgaagccatgaaaatggaaacggagatccgcactgcgttcacc
ggcacggtaacggaagttaccgttggggaaggcgatgccgtgtccagtggccaaccatta
atcttattggggtag

DBGET integrated database retrieval system