KEGG   Alteromonas mediterranea U8: I634_05685Help
Entry
I634_05685        CDS       T02722                                 

Definition
(GenBank) tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
amao  Alteromonas mediterranea U8
Pathway
amao00380  Tryptophan metabolism
amao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amao00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    I634_05685
Enzymes [BR:amao01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     I634_05685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase Hs1pro-1_C Imm30 Erf4
Motif
Other DBs
NCBI-ProteinID: AGP92863
Position
1294629..1295717
Genome map
AA seq 362 aa AA seqDB search
MKKNIEPCYYGDYLQLDKILGAQDLQSEKYGDGAHEEMLFIIVHQVYELWFKQVLHELNA
VIDTFNQEAVKDQQLTLVVHRLQRIIQIQKLMNDQIAIMETMTPQQFLSFRDYLVPASGF
QSIQFKRLEISLGLKREFRIDFDKQSFYNRLTDKDRALLENLENKPSLFELVDKWLSRMP
LLKTEDFDFWQYYKDAADEMLNDDHHTVSTSDMLSDTEKRQEIKDLQATMENFDALFNET
QFEKLRGEGKFRLSHKALLSALFIKQYSEEPIFNLPFQLITALTEIDEQLTIWRYRHAMM
VQRMLGTKIGTGGSSGHHYLKKTTESNRIYLDFFNMATFLLPKSALPDLPESVRRRLGFY
LQ
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaacatagagccctgctattacggcgattatctgcaattagataaaatatta
ggggcccaagacttacaaagtgaaaaatacggtgatggggctcacgaagaaatgctcttt
atcatagtgcatcaggtttacgagttgtggtttaaacaagtccttcacgaacttaacgcg
gtaattgatacattcaatcaagaggcggtaaaagatcagcaactcacgctggtggtacac
agactgcagcgcataattcaaattcaaaagttaatgaatgaccagattgccattatggag
accatgacgcctcagcaatttctttcattcagggactatctggttcccgcttcaggtttc
caaagtattcagtttaaacggttagaaatatcccttggcttaaagcgagagtttcgcatt
gattttgataagcaaagtttctacaaccgtttaactgataaagacagagccttattagaa
aacctcgaaaataaacctagcctgtttgaattggttgataagtggctgtctcgaatgcca
ttgctaaaaacagaggattttgatttttggcagtattataaagatgcggctgacgaaatg
ttgaacgatgatcatcacaccgtctcaaccagcgacatgttgtctgatacagaaaagcga
caagagataaaagacttacaagcgaccatggaaaacttcgacgcgttgtttaacgaaaca
cagttcgaaaagctaagaggcgagggcaagtttcgtttaagtcataaggccttactatca
gcactgtttataaagcagtactcagaagaaccaatctttaatctacctttccaacttatt
actgcgttaaccgaaatagacgagcagttgacaatctggcgttatcgtcacgctatgatg
gttcaacgcatgttagggaccaaaatagggacagggggctcatcaggccatcattatctt
aagaagaccacagaatccaaccgtatttacttagacttctttaatatggcgacctttcta
ttaccaaaaagtgctttgccggatttaccagaatccgttcgtcgacggttagggttttat
ttgcaatag

DBGET integrated database retrieval system