KEGG   Alteromonas mediterranea U8: I634_08470Help
Entry
I634_08470        CDS       T02722                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
amao  Alteromonas mediterranea U8
Pathway
amao00071  Fatty acid degradation
amao00072  Synthesis and degradation of ketone bodies
amao00280  Valine, leucine and isoleucine degradation
amao00310  Lysine degradation
amao00362  Benzoate degradation
amao00380  Tryptophan metabolism
amao00620  Pyruvate metabolism
amao00630  Glyoxylate and dicarboxylate metabolism
amao00640  Propanoate metabolism
amao00650  Butanoate metabolism
amao00900  Terpenoid backbone biosynthesis
amao01100  Metabolic pathways
amao01110  Biosynthesis of secondary metabolites
amao01120  Microbial metabolism in diverse environments
amao01130  Biosynthesis of antibiotics
amao01200  Carbon metabolism
amao01212  Fatty acid metabolism
amao02020  Two-component system
Brite
KEGG Orthology (KO) [BR:amao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    I634_08470
   00630 Glyoxylate and dicarboxylate metabolism
    I634_08470
   00640 Propanoate metabolism
    I634_08470
   00650 Butanoate metabolism
    I634_08470
  09103 Lipid metabolism
   00071 Fatty acid degradation
    I634_08470
   00072 Synthesis and degradation of ketone bodies
    I634_08470
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    I634_08470
   00310 Lysine degradation
    I634_08470
   00380 Tryptophan metabolism
    I634_08470
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    I634_08470
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    I634_08470
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    I634_08470
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amao04147]
    I634_08470
Enzymes [BR:amao01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     I634_08470
Exosome [BR:amao04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   I634_08470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ChlamPMP_M CHGN
Motif
Other DBs
NCBI-ProteinID: AGP93409
Position
1934283..1935464
Genome map
AA seq 393 aa AA seqDB search
MRDAVIVSTARTPIGRAYKGALNNLPAPSLGGHAIENAVSRAGIDPASVDDVIMGAALTQ
GSGGMNIGRLAGLAGGLPVTVAGMTLDRQCSSGMYAIATAANAIRTGDTNIMVAGGLDSI
SLVQNKNMNMFRAVDPALVAKHKDIYMPMLQTAEVVGKRYNISRDVQDEYGYQSQMRTAA
AQEAGKFDDEIVPITAVQAVFNKETGETSEREVTLSKDEGNRPETTLEGLKALNPVIEGG
CITAGNASQLSDGASATVIMDEQSAAKGSAQPIGIYRGIAVAGCEPDEMGIGPVFAIPKL
LKQHGLTMDDIGLWELNEAFAVQVLYCRDKLGIPDELLNVNGGAISIGHPYGMSGARMVG
HALIEGKRRGAKYVVCTMCIGGGMGAAGLFEVI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgatgcagtaattgtaagtacagcacgtacaccaataggccgtgcctataaaggc
gcactaaacaacttacccgcgccgtcgttaggtggtcatgccattgaaaatgcggtatct
cgtgcgggtattgaccctgctagcgtagatgacgtcatcatgggcgcagcgctcacacaa
ggcagcggtggtatgaacatcggccggttagccgggcttgccggcggccttcctgttacg
gttgcgggtatgacccttgaccgtcaatgtagttcaggtatgtacgccatcgctacagca
gcaaatgctattcgtactggcgataccaacattatggtagccggtggtttagattctatt
tcactggtacaaaacaagaacatgaatatgttccgtgccgttgaccctgcacttgttgct
aagcacaaagatatctacatgccgatgcttcaaaccgctgaagtggtaggcaagcgttat
aacattagccgcgatgtacaagatgagtacggctaccaaagtcaaatgcgcacagcagca
gcgcaagaggccggtaagtttgacgacgaaattgtacctattacagcagttcaagcggtg
ttcaataaagaaacgggtgaaacctctgagcgcgaagtcaccttgtctaaagatgaaggt
aatcgcccagaaactactcttgaaggtttgaaagcgttaaaccctgttattgaaggcggc
tgcattacagctggcaacgcgagccagctttcagacggcgcaagtgcaacagttattatg
gatgagcagtcagcagcgaaaggcagtgctcagccaattggtatttatcgcggtattgca
gtggcaggctgtgaacctgatgaaatgggaattggcccggtattcgccattcctaagcta
ttaaagcagcatggattaaccatggacgatatcggtctatgggaacttaacgaagcattt
gcagtacaggtactctactgccgcgacaagttaggtattccagacgaattattaaatgta
aacggcggtgccatttctattggtcacccatacggcatgagcggtgctcgcatggtgggt
cacgcactcatcgaaggtaaacgacgtggtgcgaaatatgtagtttgcaccatgtgtatc
ggtggcggcatgggcgctgctggtctatttgaagttatatag

DBGET integrated database retrieval system