KEGG   Alteromonas mediterranea U8: I634_08540Help
Entry
I634_08540        CDS       T02722                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase protein
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
amao  Alteromonas mediterranea U8
Pathway
amao00790  Folate biosynthesis
amao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amao00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    I634_08540
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amao04147]
    I634_08540
Enzymes [BR:amao01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     I634_08540
Exosome [BR:amao04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   I634_08540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AGP93423
Position
1951311..1951613
Genome map
AA seq 100 aa AA seqDB search
MATKLVESEIENKLEALNALITDDTPWERSGDSIKKTFTFKSFIRAFGWMSQMAIWAEKL
KHHPEWFNVYNKVEVTLTTHDAGGLTELDFSLAEKMEKFK
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atggctacaaaactggtagaaagtgaaattgagaataaacttgaagcactcaacgctctg
ataactgatgacaccccttgggagcgcagtggtgatagcattaaaaaaacatttacgttt
aaaagctttattcgggcgtttgggtggatgtcgcaaatggctatttgggctgagaagcta
aagcatcatccagaatggtttaacgtttacaataaagtagaagtaactttgaccacccat
gacgccggtggattgactgaactggatttctcgcttgctgaaaaaatggaaaaatttaaa
taa

DBGET integrated database retrieval system