KEGG   Alteromonas mediterranea U8: I634_09720Help
Entry
I634_09720        CDS       T02722                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
amao  Alteromonas mediterranea U8
Pathway
amao00480  Glutathione metabolism
amao00590  Arachidonic acid metabolism
amao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amao00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    I634_09720
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    I634_09720
Enzymes [BR:amao01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     I634_09720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AGP93657
Position
complement(2217016..2217507)
Genome map
AA seq 163 aa AA seqDB search
MELYQHSLTLNTGEQTTLEQYKGKVLLIVNTASKCGFTPQYEGLEALYKKYHDKGFEILG
FPCDQFGHQEPGSDEDIAQFCTLNFGVSFPLFKKTNVNGPDANPLFEALKNEAPGLLGSK
RIKWNFTKFLINAEGKVLKRYAPTIKPSSIDSDIAELLEKNSE
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
ttggaactctatcagcattccctcacgctaaataccggcgagcaaaccaccttggaacaa
tacaaagggaaggtgttgcttatagtgaatactgccagcaagtgcggttttacgccgcaa
tatgaggggcttgaagcgctctataaaaagtatcatgacaaaggctttgaaatattaggt
tttccttgcgaccaattcggacaccaagagccgggaagtgatgaagacattgcacaattt
tgcacgcttaattttggtgtgtcttttccactgttcaaaaaaactaacgttaacggccca
gacgccaacccgttgtttgaggcattaaaaaacgaagcacccggcctgttagggtctaag
cgaataaaatggaacttcactaagtttcttataaacgcagaaggtaaagtattaaaacgt
tacgcaccgaccataaagccctcttccatcgatagcgatatcgcagaactattagaaaag
aatagcgaatga

DBGET integrated database retrieval system