KEGG   Alteromonas mediterranea U8: I634_10990Help
Entry
I634_10990        CDS       T02722                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
amao  Alteromonas mediterranea U8
Pathway
amao00480  Glutathione metabolism
amao00590  Arachidonic acid metabolism
amao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amao00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    I634_10990
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    I634_10990
Enzymes [BR:amao01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     I634_10990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AGP93905
Position
2488304..2488858
Genome map
AA seq 184 aa AA seqDB search
MKTKGYAAALLSLSLFTSLSYANECPSVLKFMKRKLNSQETVNLCDEYAGKTLLVVNTAS
YCGYTPQFEGLEALYRNYKDKDFAVLGFPSHDFNQEDSDEGKTAELCELTYGVKFPMFEP
IYVKGDDADPMYLMLKNATGKAPSWNFNKYLIDSSGKQITHYPSSTKPTDAAFIADIEAL
LKSE
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaagactaaaggttatgcggctgccctactttcacttagtttattcacatctttgagc
tacgcgaacgagtgccctagcgtacttaaatttatgaagcgtaaactcaattctcaagaa
accgtaaacttgtgtgacgagtacgcaggaaaaaccttgttggttgttaacactgcgagt
tattgtggttacacgccccagtttgaaggtttagaagcactttaccgcaactacaaagac
aaagattttgccgtgttgggttttccttctcacgattttaatcaagaagatagcgatgaa
ggtaaaactgctgaattgtgtgaactaacctatggcgttaagttcccgatgtttgagccg
atttatgttaaaggtgacgatgccgaccctatgtaccttatgcttaaaaacgcgacaggc
aaagccccatcttggaatttcaacaagtaccttattgatagttcagggaaacaaattacc
cactaccctagttcaactaagcccacagatgcagcgtttattgcagatatagaagccttg
cttaaaagcgaatag

DBGET integrated database retrieval system